BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0505 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36653| Best HMM Match : ACBP (HMM E-Value=3.6) 34 0.11 SB_25596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_21719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_15897| Best HMM Match : DUF134 (HMM E-Value=7.5) 33 0.19 SB_8672| Best HMM Match : PKD_channel (HMM E-Value=1.4e-38) 33 0.26 SB_21967| Best HMM Match : BAG (HMM E-Value=1.7e-18) 32 0.45 SB_34257| Best HMM Match : DUF1172 (HMM E-Value=1.3) 31 0.59 SB_52001| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_21591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_56851| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_44902| Best HMM Match : EGF (HMM E-Value=9.6e-06) 30 1.4 SB_1693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52916| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) 30 1.4 SB_27218| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.42) 30 1.4 SB_26379| Best HMM Match : HALZ (HMM E-Value=1.4) 30 1.4 SB_25550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_20735| Best HMM Match : HALZ (HMM E-Value=4.6) 30 1.4 SB_37031| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_48579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7) 29 2.4 SB_27856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_38913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_7016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_646| Best HMM Match : MGAT2 (HMM E-Value=2.1) 29 3.2 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_59429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_50158| Best HMM Match : Toxin_16 (HMM E-Value=2) 29 4.2 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_6496| Best HMM Match : Collagen (HMM E-Value=0) 29 4.2 SB_19112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 28 5.5 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 28 5.5 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.5 SB_32607| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_38787| Best HMM Match : Nop17p (HMM E-Value=0.34) 28 7.3 SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 7.3 SB_20965| Best HMM Match : Fz (HMM E-Value=3.1) 28 7.3 SB_4274| Best HMM Match : LRV (HMM E-Value=5.7) 28 7.3 SB_53143| Best HMM Match : PKD (HMM E-Value=2.7e-18) 27 9.7 SB_51503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_47057| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.94) 27 9.7 SB_39171| Best HMM Match : EzrA (HMM E-Value=0.16) 27 9.7 SB_33208| Best HMM Match : Pepsin-I3 (HMM E-Value=4.7) 27 9.7 SB_10596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 27 9.7 SB_25164| Best HMM Match : FMN_dh (HMM E-Value=3.1e-13) 27 9.7 SB_23339| Best HMM Match : I-set (HMM E-Value=1.3e-07) 27 9.7 >SB_36653| Best HMM Match : ACBP (HMM E-Value=3.6) Length = 206 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +2 Query: 44 NKMFRDKTDVTLISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELKRPAVDCKIRWIN 223 +K FR + L V+ PVLYD + + D N +E W+++ ++ + K +++N Sbjct: 12 DKNFRGEE--ALAEAVRAFPVLYDKSIKDFKDKNKKENAWKQVAEQAGCSVDEAKRKFLN 69 Query: 224 IRD 232 +R+ Sbjct: 70 LRN 72 >SB_25596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/81 (22%), Positives = 43/81 (53%) Frame = +2 Query: 44 NKMFRDKTDVTLISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELKRPAVDCKIRWIN 223 +K FR + + V+ PVLYD + + D N +E W+++ ++ + K +++N Sbjct: 12 DKNFRGEEAIA--EAVRAFPVLYDKSIKDFKDKNKKENAWKQVAEQAGCSVDEAKRKFLN 69 Query: 224 IRDVHRRLWKKRLSDPNRSSK 286 +R+ + + K ++ ++S + Sbjct: 70 LRNRYSK-DKNKIKSKSKSGE 89 >SB_21719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 33.5 bits (73), Expect = 0.15 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = +3 Query: 342 PSPWTVVTAITKRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRN 521 P+P K+ NG N+ S K+ + + S ++ Q + LT Sbjct: 42 PAPTAASAPEEKKNKKKNGEKNKEPSQKQALAEGAKDASLEIYSSFRQVFGAQLDLTSET 101 Query: 522 LRPP-TSAILAPLQNSTPL 575 +PP TS + P+Q +TP+ Sbjct: 102 RQPPETSTPVTPIQETTPI 120 >SB_15897| Best HMM Match : DUF134 (HMM E-Value=7.5) Length = 311 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +2 Query: 77 LISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELKRPAVDCKIRWINIRDVH-RRLWK 253 LI+L +++ LYD + Y + R + ++ I ++L + K + N+R + + +WK Sbjct: 28 LITLWREHEELYDLRHVDYPKRDRRRLAFKHISEQLGITVPEIKKKMTNLRTYYTKEIWK 87 Query: 254 KRLSDPNRSSKPYK 295 +R + +P K Sbjct: 88 ERPGGKMGTDEPSK 101 >SB_8672| Best HMM Match : PKD_channel (HMM E-Value=1.4e-38) Length = 1523 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = +2 Query: 242 RLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQ 421 R +K R K E ++ KDV++ +D D + E D ++D+E+ + Sbjct: 1236 RKLQKEAEKETRDIFKNKAEDSGGIGESINKDVSVDIDGKDENNEHDDDHDFDDENDDDY 1295 Query: 422 QENNSDSSD 448 +N+ D D Sbjct: 1296 DDNDDDDGD 1304 >SB_21967| Best HMM Match : BAG (HMM E-Value=1.7e-18) Length = 336 Score = 31.9 bits (69), Expect = 0.45 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Frame = +2 Query: 185 KRPAVDCKIRWINIRDVHRRLWKKRLSDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGD 364 K+ KI + RD + + D ++ SK + +++ + ++ AI ++ D Sbjct: 115 KKDVKQIKIIREDSRDTNEEMAVPDFKDCSKESKQ-ETNTEIPLSEIQNEEGAITSENAD 173 Query: 365 CDYEEKDYDEWDNESGQEQQ-ENNSDSSD 448 + E + DE DN GQ+ + + S+SSD Sbjct: 174 SEIEYESADEGDNSDGQQMEVDGESNSSD 202 >SB_34257| Best HMM Match : DUF1172 (HMM E-Value=1.3) Length = 304 Score = 31.5 bits (68), Expect = 0.59 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +3 Query: 375 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 551 K+ NG N+ S K+ + + S ++ Q + LT +PP TS + Sbjct: 4 KKNKKKNGEKNKEPSQKQALAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTSVT 63 Query: 552 PLQNSTPL 575 P+Q +TP+ Sbjct: 64 PIQETTPI 71 >SB_52001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 332 KDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 KDV D DCD K + D++ G + NN D D+ Sbjct: 13 KDVGDGDDDDDCDVYYKGDGDADDDDGDDDGNNNDDDDDD 52 >SB_31911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1312 Score = 31.1 bits (67), Expect = 0.78 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 293 KYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQEN 430 K+ES++ M+ +Y+ V S D D D+WD + E +N Sbjct: 1077 KFESRLEMMREYYQQVETECQSTDEDPFFDPEDKWDKDFKMESPQN 1122 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 448 + D + EE+D E DN+ G+E++E D+ D Sbjct: 212 EDDDDEVEERDETENDNDEGEEREEMEDDNDD 243 >SB_34910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2147 Score = 31.1 bits (67), Expect = 0.78 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +3 Query: 360 VTAITK--RKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP 533 VT++T+ R + + T + RS + T V +S + +ESR S +T PP Sbjct: 844 VTSVTQESRSSQVTSATQESRSTQVTSVT---QESHSTQVTSATQESRSSQVTSVTQEPP 900 Query: 534 TSAILAPLQNSTPLTRLTHSS 596 +S + + Q S P T++T ++ Sbjct: 901 SSQVTSVTQES-PSTQVTSAT 920 Score = 30.7 bits (66), Expect = 1.0 Identities = 23/89 (25%), Positives = 46/89 (51%), Gaps = 2/89 (2%) Frame = +3 Query: 336 TLPSPWTVVTAITKR--KTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHL 509 T S ++ VT++T+ + + T + RS++ T V +SR + +ESR S + Sbjct: 1328 TQESRYSQVTSVTQEPPSSQVTSVTQESRSSQVTSVT---QESRSSQVTSVTQESRSSQV 1384 Query: 510 TRRNLRPPTSAILAPLQNSTPLTRLTHSS 596 T PP++ + + Q S P +++T ++ Sbjct: 1385 TSATQEPPSTQVTSVTQES-PSSQVTSAT 1412 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = +3 Query: 360 VTAITKRK--TMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP 533 VT++T+ T + T + RS++ T V +SR + +ESR S +T PP Sbjct: 1180 VTSVTQESSSTQVTSATQESRSSQVTSVT---QESRSSQVTSVTQESRSSQVTSATQEPP 1236 Query: 534 TSAILAPLQNSTPLTRLTHSS 596 ++ + Q S P T++T ++ Sbjct: 1237 STQATSVTQES-PSTQVTSAT 1256 Score = 29.9 bits (64), Expect = 1.8 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 11/88 (12%) Frame = +3 Query: 336 TLPSPWTVVTAITKR--KTMMNGTTNQGRSNKRTIVI--PPMNQ-------SRKLRGGVN 482 T P T VT++T+ T + T + RS++ T V PP +Q S + Sbjct: 932 TQEPPSTQVTSVTQEPPSTQVTSATQESRSSQVTSVTQNPPSSQVTSVTQESHSTQVTSA 991 Query: 483 QKESRKSHLTRRNLRPPTSAILAPLQNS 566 +ESR S +T PP+S + + Q S Sbjct: 992 TQESRSSQVTSVTQEPPSSQVTSVTQES 1019 Score = 28.3 bits (60), Expect = 5.5 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 6/93 (6%) Frame = +3 Query: 336 TLPSPWTVVTAITKRK--TMMNGTTNQGRSNKRTIVI--PPMNQSRKLRGGVNQKESRKS 503 T SP T VT+ T+ + + T + S + T V PP Q +ESR S Sbjct: 908 TQESPSTQVTSATQESPSSQVTSVTQEPPSTQVTSVTQEPPSTQVTSAT-----QESRSS 962 Query: 504 HLTRRNLRPPTSAILAPLQ--NSTPLTRLTHSS 596 +T PP+S + + Q +ST +T T S Sbjct: 963 QVTSVTQNPPSSQVTSVTQESHSTQVTSATQES 995 >SB_21591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.1 bits (67), Expect = 0.78 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D D D ++ D D+ D+E +E++E N D D+ Sbjct: 47 DDDDDDDDDDDDDDDDDEEEEEEEEENDDDDDD 79 >SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2835 Score = 30.7 bits (66), Expect = 1.0 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 362 DCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D D ++DYD+ DN+ + ++N D +D+ Sbjct: 64 DDDDSDEDYDDDDNDDNDDDNDDNDDDNDD 93 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWD--NESGQEQQENNSDSSDE 451 D D DY++ D D+ D N+ + ++N D +D+ Sbjct: 66 DDSDEDYDDDDNDDNDDDNDDNDDDNDDNDDDNDD 100 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D GD DY + D+++ D++ + NN D ++ Sbjct: 29 DDGD-DYSDSDHNDDDDDDDNDSDNNNVDDDND 60 >SB_56851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D D DY++KD D++DN+ + ++N D D+ Sbjct: 56 DDDDDDYDDKDNDDYDND--DDVDDDNDDYDDD 86 >SB_44902| Best HMM Match : EGF (HMM E-Value=9.6e-06) Length = 335 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 448 D GD + +E D D D+E E E++ DS D Sbjct: 225 DDGDSEDDEDDGDSEDDEDDGEDDEDDGDSED 256 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 359 GDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 GD D EE D D D+E + +++ D D+ Sbjct: 218 GDSDDEEDDGDSEDDEDDGDSEDDEDDGEDD 248 >SB_1693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +3 Query: 375 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 551 K+ NG N+ S K+ + S ++ Q + LT +PP TS + Sbjct: 72 KKNKKKNGEKNKEPSQKQAFAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTPVT 131 Query: 552 PLQNSTPL 575 P+Q +TP+ Sbjct: 132 PIQETTPI 139 >SB_52916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 326 FYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSD 439 +Y D A + D++E+ D+WD + G ++E D Sbjct: 390 WYTDAAFWKQQEEADFDEETVDDWDVDMGIYEEEGGGD 427 >SB_29898| Best HMM Match : Chromadorea_ALT (HMM E-Value=0.0085) Length = 350 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 332 KDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 KD + D G+ D E ++ E D+E G E EN ++ +E Sbjct: 37 KDEPLQEDDGEEDEETQEEPEDDSEGGTENDENPGEAENE 76 >SB_27218| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.42) Length = 175 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D GD D ++ D D+ DN + N+ D++D+ Sbjct: 121 DGGDDDDDDDDNDDDDNNDDDDDDNNDDDNNDD 153 >SB_26379| Best HMM Match : HALZ (HMM E-Value=1.4) Length = 421 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +3 Query: 375 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 551 K+ NG N+ S K+ + S ++ Q + LT +PP TS + Sbjct: 72 KKNKKKNGEKNKEPSQKQAFAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTPVT 131 Query: 552 PLQNSTPL 575 P+Q +TP+ Sbjct: 132 PIQETTPI 139 >SB_25550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 329 YKDVAIP-LDSGDCDYEEKDYDEWDNESGQEQQENN 433 Y DV +D D DY++ DYD++D+ G + ++++ Sbjct: 145 YDDVDYDDVDYDDVDYDDGDYDDYDDGGGYDDKDDD 180 >SB_20735| Best HMM Match : HALZ (HMM E-Value=4.6) Length = 259 Score = 30.3 bits (65), Expect = 1.4 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = +3 Query: 375 KRKTMMNGTTNQGRSNKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPP-TSAILA 551 K+ NG N+ S K+ + S ++ Q + LT +PP TS + Sbjct: 91 KKNKKKNGEKNKEPSQKQAFAEGAKDASLEIYSSFRQVFGAQLDLTSETRQPPETSTPVT 150 Query: 552 PLQNSTPL 575 P+Q +TP+ Sbjct: 151 PIQETTPI 158 >SB_37031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 344 IPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 + LD D D ++ D D+ DN+ + ++N D D+ Sbjct: 52 VVLDDDDDDDDDDDDDDDDNDDDNDDDDDNDDDDDD 87 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQEN-----NSDSSDEPI 457 D D D E+ D E D+ES ++EN NSD D+P+ Sbjct: 463 DEHDDDDEDDDDSEGDDESSNAKEENIDSDDNSDDDDKPL 502 >SB_48579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 + GD D DY++ D +S +NN + D + Sbjct: 123 EDGDSDVRHDDYNDEDGDSDVRHDDNNDEDGDSDV 157 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 + GD D +Y++ D +S +NN D D + Sbjct: 165 EDGDSDVRHDEYNDEDGDSDVRHDDNNDDDGDSDV 199 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 + GD D +Y++ D +S +NN D D + Sbjct: 263 EDGDSDVRHDEYNDEDGDSDVRHDDNNDDDGDSDV 297 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 D GD D D ++ D +S +NN D D + Sbjct: 67 DDGDSDVRHDDNNDEDGDSDVRHDDNNDDDGDSDV 101 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 D GD D +Y++ D +S +NN + D + Sbjct: 95 DDGDSDVRHDEYNDDDGDSDVRHDDNNDEDGDSDV 129 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 D GD D D ++ D +S +NN D D + Sbjct: 39 DDGDSDVRHDDNNDDDGDSDVRHDDNNDDDGDSDV 73 Score = 27.9 bits (59), Expect = 7.3 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 + GD D +Y++ D +S +NN + D + Sbjct: 221 EDGDSDVRHDEYNDEDGDSDVRHDDNNDEDGDSDV 255 >SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7) Length = 241 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 374 EEKDYDEWDNESGQEQQENNSDSSDE 451 E +D D+ D+E +E +E+ D SDE Sbjct: 199 ESEDSDDGDDEDDEEDEEDEKDESDE 224 >SB_27856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D+G D +++DYD ++ E +N D DE Sbjct: 229 DNGHDDDDDEDYDNGHDDDDDEDYDNGHDDEDE 261 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D+G D +++DYD ++ E +N D D+ Sbjct: 217 DNGHDDDDDEDYDNGHDDDDDEDYDNGHDDDDD 249 >SB_38913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.1 bits (62), Expect = 3.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D D D ++ D D+ D+E + +++N+D D+ Sbjct: 14 DDNDDDDDDDDNDDDDDEDDDDDEDDNNDDDDD 46 >SB_7016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 9/63 (14%) Frame = +2 Query: 236 HRRLWKKRLSDPNRSSKPY------KYESQMAF-MKAFYKDVAIPLD-SGDCDYEE-KDY 388 ++ LW K SD N + KP Y S +F +A Y + +PLD + +Y E K Y Sbjct: 103 NKSLWSKEASDVNSNEKPLIIQNGTHYGSASSFSYRAMYDVLELPLDWPAEVNYHEAKAY 162 Query: 389 DEW 397 W Sbjct: 163 CAW 165 >SB_646| Best HMM Match : MGAT2 (HMM E-Value=2.1) Length = 298 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D+ D D ++++YDE D+E+ EN +D+ ++ Sbjct: 206 DNDDDDDDDENYDENDDENVGNDNENENDNEND 238 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 D GD D D ++ D +S +NN D D + Sbjct: 1802 DDGDSDVRHDDNNDEDGDSDVRHDDNNDDDGDSDV 1836 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 D GD D D ++ D +S +NN D D + Sbjct: 1830 DDGDSDVRHDDNNDDDGDSDVRHDDNNDDDGDSDV 1864 >SB_59429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D D D ++ DYD+ ++S + ++N D +D+ Sbjct: 21 DDDDDDDDDDDYDDNTDDSDDDDADHNEDDNDD 53 >SB_50158| Best HMM Match : Toxin_16 (HMM E-Value=2) Length = 746 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +3 Query: 420 NKRTIVIPPMNQSRKLRGGVNQKESRKSHLTRRNLRPPTS-AILAPLQNSTPLTRLTHSS 596 N R + +NQ +K N+K+ R+ ++ N+ A L P+ + P+ R S+ Sbjct: 111 NNRNAALSRLNQLKKRFEAANRKQYREDYIQFMNIIINNGYAELVPVIETEPIARQRRST 170 Query: 597 SA*HQH*RLSHP 632 + H L HP Sbjct: 171 TWFIPHHGLYHP 182 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNE-SGQEQQENNS-DSSD 448 D GD D +E D D W+++ SG Q N S D SD Sbjct: 33 DDGDDDDDEDDDDGWESDSSGPAQPHNTSTDLSD 66 >SB_6496| Best HMM Match : Collagen (HMM E-Value=0) Length = 1234 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 + G+CD EE + E D+E E+ E +S+ S+E Sbjct: 293 EEGECDSEESEEGECDSEE-SEEGECDSEESEE 324 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 + G+CD EE + E D+E E+ E +S+ S+E Sbjct: 303 EEGECDSEESEEGECDSEE-SEEGECDSEESEE 334 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 + G+CD EE + E D+E E+ E +S+ S+E Sbjct: 313 EEGECDSEESEEGECDSEE-SEEGECDSEESEE 344 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 448 + G+CD EE + E D+E +E + + +S + Sbjct: 323 EEGECDSEESEEGECDSEESEEGECDTEESEE 354 >SB_19112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 350 LDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 +D+GD DY++ D D+ D++ + ++ D +DE Sbjct: 13 VDNGDGDYDDDD-DDNDDDDDDDDDDDGVDGNDE 45 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 338 VAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 V I D G+ D EE D +E D+E G+E E+ + +D+ Sbjct: 1788 VLIESDDGEDD-EEVD-EEMDDEEGEEMMEDEDEEADK 1823 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 28.3 bits (60), Expect = 5.5 Identities = 22/74 (29%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +2 Query: 230 DVHRRLWKKRLSDPNRSSKPYKYE-SQMAFMKAFYKDVAIPLDSGDCDYEEKDYDEWDNE 406 +V RR S NRS P K S KA D+ + ++ D D D+E Sbjct: 772 EVPRRSSHMEDSSANRSISPVKERASSKPSEKAMEAPSGKAPDTKQKERKKTDSDSDDDE 831 Query: 407 SGQEQQENNSDSSD 448 S + ++ DSSD Sbjct: 832 SSESDSSDDEDSSD 845 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 332 KDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 KD D + D++E D S E+ ++SDSSDE Sbjct: 27 KDAETQTDPEITGVDADDFEEGDYSSSGEESGSDSDSSDE 66 >SB_32607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 448 D D + DYD DN + +NN+D D Sbjct: 51 DENDYVGDNNDYDSGDNNDKDDGSDNNNDDDD 82 >SB_38787| Best HMM Match : Nop17p (HMM E-Value=0.34) Length = 438 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 5/47 (10%) Frame = +2 Query: 212 RWINIRDVHRRLW-KKRLSDPNRSS--KPY-KYES-QMAFMKAFYKD 337 RW+ + RR+W KKR + R++ +PY ++ S +A+M+ +Y++ Sbjct: 25 RWVERLNARRRIWQKKRYTKQQRTNTDEPYLRHPSYAIAWMRGYYEE 71 >SB_29350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 288 PTNMSHKWHL*RHFIKTLPSPWTVVTAITKRKTMMNGTT 404 PT +SH++H H PSP + IT T+ TT Sbjct: 100 PTPLSHRYHHRHHHTSPSPSPPYITITITITITITTITT 138 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 332 KDVAIPLD-SGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 KD + D + CD E+ D D+ N+ + + N D D+ Sbjct: 330 KDADMDSDHNNSCDDEDYDDDDVHNDDSENDDDENDDDDDD 370 >SB_20965| Best HMM Match : Fz (HMM E-Value=3.1) Length = 529 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 335 DVAIPLDSGDCDYEEKDYDE 394 DV D GDCDYE+ ++D+ Sbjct: 33 DVGGDNDGGDCDYEDDNHDD 52 >SB_4274| Best HMM Match : LRV (HMM E-Value=5.7) Length = 327 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +2 Query: 74 TLISLVKQNPVLYDYNNPKYMDFNAREVTWQKIGDELK--RPAVDCKIRWINIRDVHRRL 247 T I + N L+++N P+Y +++ + + ELK D +I+W ++ +R+ Sbjct: 64 TFILFYQTNESLWNHNIPEYHTNRNKDLLFNCLIKELKYRYTKQDVEIKWKSLLKFYRQE 123 Query: 248 WKKRLSDPNRSSKPYKYESQMAF 316 +K P+ Y+S F Sbjct: 124 HEKAQHKPSGWGTDEVYQSSWEF 146 >SB_53143| Best HMM Match : PKD (HMM E-Value=2.7e-18) Length = 2111 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 509 QMTFPAFFLIYAAAQLS*LVHRRNHY 432 Q+T PAFFL A++S L+HR N Y Sbjct: 2079 QLTSPAFFLRLHKARIS-LIHRLNIY 2103 >SB_51503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D+GD D + D D DN+ G + + D SD+ Sbjct: 194 DNGDND-DGSDDDGGDNDDGSDDDDGGDDGSDD 225 >SB_47057| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.94) Length = 969 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +2 Query: 260 LSDPNRSSKPYKYESQMAFMKAFYKDVAIPLDSGDCDYEEKDYDE 394 +S+ NR+ ES+ + +++A+PLD D + ++ DYDE Sbjct: 618 VSEHNRTMNGLTRESRGSLTSDEEEELAVPLDYSDIE-QDVDYDE 661 >SB_39171| Best HMM Match : EzrA (HMM E-Value=0.16) Length = 587 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 197 VDCKIRWINIRDVHRRLWKKRLSDPN 274 V K + N+RD H +L KKR + PN Sbjct: 480 VQLKRDFTNLRDEHEKLLKKRSAKPN 505 >SB_33208| Best HMM Match : Pepsin-I3 (HMM E-Value=4.7) Length = 256 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 D GD D + DYD+ DN+ G ++ D +D+ Sbjct: 169 DIGD-DNDNDDYDDDDNDDGGGNDDDIGDDNDD 200 >SB_10596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +2 Query: 338 VAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSD 448 + +P D D DY++ + DE D+E G+ + D D Sbjct: 24 IMLPYDDDD-DYDDGEGDEDDDEGGRCDDDAGGDKDD 59 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 Query: 323 AFYKDVAIPLDSGDCDYEEKDYDEWDNESGQEQQENNSDSSDE 451 A +K I + D + E +YDE + + G++QQ N+ + ++ Sbjct: 1060 ANFKLKKIKREDDDEESESDEYDEDNKQDGEQQQTKNTSTDNK 1102 >SB_25164| Best HMM Match : FMN_dh (HMM E-Value=3.1e-13) Length = 270 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 353 DSGDCDYEEKDYDEWDNESGQEQQENNSDSSDEPI 457 D D D + K+ + DN+ + +N DSSD+ + Sbjct: 229 DDRDDDDDTKNDSDDDNKDDSDDDDNKDDSSDDDV 263 >SB_23339| Best HMM Match : I-set (HMM E-Value=1.3e-07) Length = 423 Score = 27.5 bits (58), Expect = 9.7 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +2 Query: 365 CDYEEKDYDEWDNESGQE 418 C Y++ DYD++DN+ ++ Sbjct: 48 CGYKDDDYDDYDNDDNED 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,954,340 Number of Sequences: 59808 Number of extensions: 316365 Number of successful extensions: 1441 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1428 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -