BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0501 (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1637| Best HMM Match : Ion_trans (HMM E-Value=7.6e-10) 30 1.3 SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) 29 4.0 >SB_1637| Best HMM Match : Ion_trans (HMM E-Value=7.6e-10) Length = 216 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 156 DAFSHWQLHT*IYNLQVLLQVKFNTQCIYYYINLNLNQTQKSSTLPSC 13 D+ WQ +N V + V F ++ YI+ N TQ SSTL C Sbjct: 59 DSLGFWQTQ---FNNMVAVAVFFAWIKVFKYISFNKTMTQLSSTLSKC 103 >SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) Length = 1068 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = -1 Query: 606 NYNPRNPSFFCEICNFKEGCTVFTKQSVTKNGKGMFKWLSNNAYEIQCAIFN 451 N+ F+ N+ C + TK+ +T++ K + KW+ +N E+ + N Sbjct: 261 NFQVEESQFYVG-ANYINICHLHTKEWLTEDDKKLKKWIQDNFAEVTQKVIN 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,724,362 Number of Sequences: 59808 Number of extensions: 345825 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -