BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0500 (477 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33412| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 6.0 SB_15789| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_33412| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 852 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 202 IYVVNVYGLQYPLNTRWTVSSPTHLAIKK*KMQHAYVS 89 + + +Q L T WT+SSP+H+ I ++ +S Sbjct: 674 LVTAGLIAVQLLLTTVWTISSPSHIHITYERLTRTVIS 711 >SB_15789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.1 bits (57), Expect = 7.9 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +2 Query: 26 QIFPLYNIIIVSIRIWPKI-DIRNIRML--HFLFFYC*MSGRTHSPPGVKWVLEPIDIYD 196 Q+F LYN + + P + D ++ + YC G H P +W P+D +D Sbjct: 144 QLFELYNFVKKHVNPSPVVLDADDLLEAPDEIMQSYCEAIGVDHEPGMTRWEPGPVDEWD 203 Query: 197 V 199 V Sbjct: 204 V 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,519,044 Number of Sequences: 59808 Number of extensions: 288737 Number of successful extensions: 402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 402 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -