BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0500 (477 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 2.4 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 22 9.6 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 2.4 Identities = 12/52 (23%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 2 RSLLNTNKQIFP-LYNIIIVSIRIWPKIDIRNIRMLHFLFFYC*MSGRTHSP 154 R ++N Q P ++N+++V + W I +++ +F C +T P Sbjct: 1421 RVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCVDKNKTTLP 1472 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = +2 Query: 137 GRTHSPPGVKWVLEPIDIYDVNAPSTLRYKF 229 G H P + P+++Y V + R++F Sbjct: 257 GTYHDPKKNETTQTPLEVYTVRRGARFRFRF 287 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 509,987 Number of Sequences: 2352 Number of extensions: 11203 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -