BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0499 (557 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 26 0.25 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 26 0.25 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 23 1.3 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 2.4 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 5.4 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 25.8 bits (54), Expect = 0.25 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 390 KITYVMYLMKLASAW-LKCQR-TPNCTQSCWSHLLC 491 +I Y + ++L + CQ TPN T + WSH C Sbjct: 119 RICYYHFTLELYTVLGAACQVCTPNATNTVWSHCQC 154 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 25.8 bits (54), Expect = 0.25 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 390 KITYVMYLMKLASAW-LKCQR-TPNCTQSCWSHLLC 491 +I Y + ++L + CQ TPN T + WSH C Sbjct: 119 RICYYHFTLELYTVLGAACQVCTPNATNTVWSHCQC 154 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 23.4 bits (48), Expect = 1.3 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -1 Query: 404 YVRDLHALSVPSDELGSACSKIGSSSEVQPASPS 303 Y DL S+ EL + GSS QPA+ S Sbjct: 223 YYGDLDLKSIRKSELLAGLQSSGSSRSHQPATKS 256 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 416 EARKRLAEVPKDTKLYSELLVTLI 487 +A K L PK K+YS LL+T + Sbjct: 11 DALKILGIGPKSNKIYSFLLLTTL 34 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 227 PSHRFLRPF 201 P HRFL PF Sbjct: 376 PDHRFLEPF 384 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,899 Number of Sequences: 336 Number of extensions: 2176 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -