BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0499 (557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045642-4|AAK67210.1| 226|Caenorhabditis elegans Vacuolar h at... 122 2e-28 Z81071-2|CAB03012.1| 618|Caenorhabditis elegans Hypothetical pr... 28 5.2 AC006644-5|AAF39834.1| 786|Caenorhabditis elegans Hypothetical ... 27 6.9 >AF045642-4|AAK67210.1| 226|Caenorhabditis elegans Vacuolar h atpase protein 8 protein. Length = 226 Score = 122 bits (294), Expect = 2e-28 Identities = 66/141 (46%), Positives = 80/141 (56%) Frame = +2 Query: 134 LSDADVQKQIKHMMAFIEQXXXXXXXXXXXXXXXXFNIEKGRLVQQQRLKIMXXXXXXXX 313 +SD DVQKQ++HMMAFIEQ FNIEKGRLVQQQR KIM Sbjct: 3 ISDNDVQKQLRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRQKIMEFFEKKEK 62 Query: 314 XXXXXXXIQSSNMLNQARLKVLKVREDHVRNVLDEARKRLAEVPKDTKLYSELLVTLIVQ 493 IQ+SN LN RL+ LK REDH+ VLDEAR L+ + D Y +L L++Q Sbjct: 63 QVELQRKIQASNSLNAGRLRCLKAREDHIGAVLDEARSNLSRISGDAARYPAILKGLVMQ 122 Query: 494 ALFQLMEPTVTIRVRQTDKAL 556 L QL+E V +R R+ D L Sbjct: 123 GLLQLLEKEVVLRCREKDLRL 143 >Z81071-2|CAB03012.1| 618|Caenorhabditis elegans Hypothetical protein F28F8.2 protein. Length = 618 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 419 LHQVHYVRDLHALSVPSDELG 357 LH++ YV D H + VP D G Sbjct: 515 LHKLDYVADAHVVGVPDDRYG 535 >AC006644-5|AAF39834.1| 786|Caenorhabditis elegans Hypothetical protein F55A3.2 protein. Length = 786 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +1 Query: 331 EDPIFEHAEPSSSEGTESA*RSRT 402 E PI E +EP SSE +ES RSR+ Sbjct: 369 ELPILEVSEPGSSEPSESRTRSRS 392 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,117,714 Number of Sequences: 27780 Number of extensions: 202469 Number of successful extensions: 576 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -