BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0497 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 28 0.23 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 25 2.1 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 24 4.9 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 8.5 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 23 8.5 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 23 8.5 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 28.3 bits (60), Expect = 0.23 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 264 GSSADFKSKKYPLXVDEYEPDTFDVL--KHRINQRFTNGGNKLVNINLSDSDQLLSY 428 GSS+ P VDE+E + ++L KH+ N R + +LVNI L +L Y Sbjct: 76 GSSSPHAPNGTP-PVDEHERELINMLEQKHKQNYRILDLEARLVNITLEKLCELCKY 131 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 25.0 bits (52), Expect = 2.1 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = -1 Query: 478 KDCFLTFGISKSPNTFEYDKS*SESLKLIFTSLLPPLVKR*L-ILC---FNTSKVSGSYS 311 K+C I KSP+ YD + ++LK L+ P+ K+ + +LC F+ S G+ Sbjct: 45 KNCSYVRKILKSPDFSHYDTTYLDTLKC--GDLMVPMRKKPIPLLCCPKFSNSPTCGAQQ 102 Query: 310 STXKGYF 290 + YF Sbjct: 103 LADRIYF 109 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.8 bits (49), Expect = 4.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 95 FLWFQ*NFRESFKRNIFCF 151 + W NFR+ FK+ + CF Sbjct: 380 YAWLNDNFRKEFKQVLPCF 398 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 8.5 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +3 Query: 39 IGINASGELSILHSP-ESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFN 215 I + G L + P L F G LLK I S SL + ++ + G ++D F+ Sbjct: 79 IFLKTDGSLLWKNKPVRELLFEGVKDPLLDLLKTINSTSLNIPFDKFGWFVGRNLSDTFD 138 Query: 216 TPEAVVEVYISGISSLG 266 + G+ S+G Sbjct: 139 -GTFTMRTGADGLESMG 154 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 23.0 bits (47), Expect = 8.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 262 RLDMPLM*TSTTASGVLNGSVINNPFH 182 +LDM + ST A GV GS+ N H Sbjct: 274 KLDMVHVQNSTLAGGVAVGSICNLLIH 300 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 226 ASGVLNGSVINNPF 185 A VLNG +INNP+ Sbjct: 134 ALAVLNGYLINNPY 147 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,697 Number of Sequences: 2352 Number of extensions: 11003 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -