BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0495 (636 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 26 0.27 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.4 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 4.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.7 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.7 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.7 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.7 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.7 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 26.2 bits (55), Expect = 0.27 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +3 Query: 189 PPSTPPLMENKVELPLKKIAAKRARESSS--PPAGL 290 PP TPP EN +++ L+ I + R +++ P AG+ Sbjct: 45 PPVTPPQGENMLDMDLRGIYSNRTDFTTTFRPTAGM 80 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/15 (66%), Positives = 10/15 (66%), Gaps = 1/15 (6%) Frame = +3 Query: 441 SPEPLPPPPA-HGMN 482 SPEP PPPP H N Sbjct: 1856 SPEPPPPPPRNHDQN 1870 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 466 GGGGRGSGLQVPSLWARMMT 407 G G G GLQ SLWA +T Sbjct: 761 GRSGYGIGLQKGSLWADAVT 780 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 429 DGTCSPEPLPPPP 467 D P+P PPPP Sbjct: 334 DSDTPPKPAPPPP 346 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 444 PEPLPPPPAHGMNML 488 P P PPPP+ G L Sbjct: 1355 PPPPPPPPSSGQAYL 1369 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 472 CAGGGGRGSGLQVPSL 425 CAGGGGR S + SL Sbjct: 9 CAGGGGRLSSVLSLSL 24 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 472 CAGGGGRGSGLQVPSL 425 CAGGGGR S + SL Sbjct: 9 CAGGGGRLSSVLSLSL 24 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 472 CAGGGGRGSGLQVPSL 425 CAGGGGR S + SL Sbjct: 9 CAGGGGRLSSVLSLSL 24 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 472 CAGGGGRGSGLQVPSL 425 CAGGGGR S + SL Sbjct: 9 CAGGGGRLSSVLSLSL 24 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 447 EPLPPPP 467 EPLPPPP Sbjct: 373 EPLPPPP 379 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 5.7 Identities = 12/55 (21%), Positives = 23/55 (41%) Frame = +2 Query: 326 RVQQAIPMRAGALASHDAAPGAVLQALGHHAGPQGRHLQSGASAAPARARHEHAQ 490 ++Q A G++ +P V + H Q H+Q ++A+ +H Q Sbjct: 142 KLQAAAVDHQGSVLDGPDSPPLVESQMHHQMHTQHPHMQPQQGQHQSQAQQQHLQ 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,203 Number of Sequences: 438 Number of extensions: 3217 Number of successful extensions: 20 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -