BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0485 (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40300.1 68415.m04964 ferritin, putative similar to ferritin ... 41 7e-04 At3g56090.1 68416.m06234 ferritin, putative similar to ferritin ... 41 0.001 At5g01600.1 68418.m00075 ferritin 1 (FER1) identical to ferritin... 38 0.005 At3g11050.1 68416.m01333 ferritin, putative similar to ferritin ... 34 0.11 At5g17220.1 68418.m02018 glutathione S-transferase, putative 30 1.3 At1g67230.1 68414.m07652 expressed protein 30 1.3 At2g44630.1 68415.m05555 kelch repeat-containing F-box family pr... 29 2.3 At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, pu... 28 5.2 At2g31960.1 68415.m03905 glycosyl transferase family 48 protein ... 28 5.2 At2g06200.1 68415.m00682 expressed protein 28 5.2 At2g26660.1 68415.m03198 SPX (SYG1/Pho81/XPR1) domain-containing... 27 9.2 At1g68670.1 68414.m07846 myb family transcription factor contain... 27 9.2 >At2g40300.1 68415.m04964 ferritin, putative similar to ferritin subunit cowpea2 precursor [Vigna unguiculata] GI:2970654; contains Pfam profile PF00210: Ferritin-like domain Length = 259 Score = 41.1 bits (92), Expect = 7e-04 Identities = 27/104 (25%), Positives = 50/104 (48%) Frame = +2 Query: 377 SYHYLLSASYFNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKMDFSSHTTLKG 556 SY Y +YF+ +G AK F++ S + E L+++ KRGG++ S + Sbjct: 112 SYVYHAMYAYFDRDNIALKGLAKFFKESSLEEREHAEKLMEYQNKRGGRVKLQS---IVM 168 Query: 557 DKGSNYTVEVGHEIGALAKALDTQKQLAERIFFIHREVTKNSDL 688 V+ G + + AL +K + E++ +H +KN+D+ Sbjct: 169 PLSEFEHVDKGDALYGMELALSLEKLVNEKLLNLHSVASKNNDV 212 >At3g56090.1 68416.m06234 ferritin, putative similar to ferritin subunit cowpea2 precursor [Vigna unguiculata] GI:2970654; contains Pfam profile PF00210: Ferritin-like domain Length = 259 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/104 (25%), Positives = 49/104 (47%) Frame = +2 Query: 377 SYHYLLSASYFNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKMDFSSHTTLKG 556 SY Y +YF+ +G AK F++ S + E L+++ KRGG++ + Sbjct: 110 SYVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYQNKRGGRVKLQPMVLPQS 169 Query: 557 DKGSNYTVEVGHEIGALAKALDTQKQLAERIFFIHREVTKNSDL 688 + E G + A+ AL +K + E++ +H +KN D+ Sbjct: 170 EFDH---PEKGDALYAMELALSLEKLVNEKLLNLHSVASKNDDV 210 >At5g01600.1 68418.m00075 ferritin 1 (FER1) identical to ferritin [Arabidopsis thaliana] GI:1246401, GI:8163920 Length = 255 Score = 38.3 bits (85), Expect = 0.005 Identities = 34/151 (22%), Positives = 69/151 (45%), Gaps = 4/151 (2%) Frame = +2 Query: 245 YQNVDQGCRRTLSLP---HCSAYYGQFKD-NHVVANELKALASLYLKRSYHYLLSASYFN 412 +Q ++ + L++P H S +F D + V NE ++ SY Y +YF+ Sbjct: 64 FQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQ---INVEYNVSYVYHSMYAYFD 120 Query: 413 NYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKMDFSSHTTLKGDKGSNYTVEVGH 592 +G AK F++ S++ +++ +RGG++ H + + E G Sbjct: 121 RDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGGRVKL--HPIVSPISEFEH-AEKGD 177 Query: 593 EIGALAKALDTQKQLAERIFFIHREVTKNSD 685 + A+ AL +K E++ +H+ ++N+D Sbjct: 178 ALYAMELALSLEKLTNEKLLNVHKVASENND 208 >At3g11050.1 68416.m01333 ferritin, putative similar to ferritin subunit cowpea2 precursor GI:2970654 (Vigna unguiculata); contains Pfam profile PF00210: Ferritin-like domain Length = 253 Score = 33.9 bits (74), Expect = 0.11 Identities = 26/104 (25%), Positives = 44/104 (42%) Frame = +2 Query: 377 SYHYLLSASYFNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKMDFSSHTTLKG 556 SY Y +YF+ +GFAK F S + +++ KRGG++ S Sbjct: 104 SYVYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEMFMEYQNKRGGRVKLQSILMPVS 163 Query: 557 DKGSNYTVEVGHEIGALAKALDTQKQLAERIFFIHREVTKNSDL 688 + E G + A+ AL +K E++ + KN+D+ Sbjct: 164 EFDHE---EKGDALHAMELALSLEKLTNEKLLKLQSVGVKNNDV 204 >At5g17220.1 68418.m02018 glutathione S-transferase, putative Length = 214 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +2 Query: 302 YYGQFKDNHVVANELKALASLYLKRSYHYLLSASYFNNYQTNREGFAKLFRKLSD-DSWE 478 Y + N +A E +A L + YL+S + N R F + + ++SD SW+ Sbjct: 147 YNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMVKARGSFNRWWEEISDRPSWK 206 Query: 479 KTIGLIKH 502 K + L H Sbjct: 207 KLMVLAGH 214 >At1g67230.1 68414.m07652 expressed protein Length = 1132 Score = 30.3 bits (65), Expect = 1.3 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 4/99 (4%) Frame = +2 Query: 419 QTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRGGKMDFSSHTT---LKGDK-GSNYTVEV 586 + RE F K + +L D+ K +K++T + K++ H LK +K +N +E Sbjct: 515 KAQRESFEKEWEEL-DERKAKIGNELKNITDQKEKLERHIHLEEERLKKEKQAANENMER 573 Query: 587 GHEIGALAKALDTQKQLAERIFFIHREVTKNSDLLHDAE 703 E +AKA + ER + ++ S LLHD E Sbjct: 574 ELETLEVAKASFAETMEYERSMLSKKAESERSQLLHDIE 612 >At2g44630.1 68415.m05555 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF00646: F-box domain, PF01344: Kelch motif Length = 372 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +2 Query: 338 NELKALASLYLKRSYHYLLSASYFNNYQTNREGFAKLFRKLSDDSWEKT 484 NE AS+ L R + L S Y N+Y T R+G + + + +D+W KT Sbjct: 218 NEWFTHASVSLDRKVYALNSREYMNSYDT-RDGSYQRY-TIPEDNWWKT 264 >At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative similar to rof1 [Arabidopsis thaliana] GI:1373396 Length = 578 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +2 Query: 467 DSWEKTIGLIKHVTKRGGKMDFSSHTTLKGDKGSNYTVEVGHEIGALAKALDTQKQ 634 + WEK L + K +++ T + G +TV+ GH AL+KA+ T K+ Sbjct: 173 EKWEKPKDLDEVYVKYEARLE--DGTIVGKSDGVEFTVKEGHFCPALSKAVKTMKR 226 >At2g31960.1 68415.m03905 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase; contains non-consensus splice aite AC at exon 33 Length = 1959 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 407 FNNYQTNREGFAKLFRKLSDDSWEKTIGLIKHVTKRG 517 +N + NR G K + WEK IG ++H KRG Sbjct: 1729 WNKWIYNRGGIGVPPEKSWESWWEKEIGHLRHSGKRG 1765 >At2g06200.1 68415.m00682 expressed protein Length = 244 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 519 PPLLVTCFMRPMVFSHESSDNFLKSFANPSL 427 PP L+ RP +FS SS + SF +P+L Sbjct: 32 PPHLLFLIKRPFLFSSSSSSSSSSSFFSPTL 62 >At2g26660.1 68415.m03198 SPX (SYG1/Pho81/XPR1) domain-containing protein low similarity to NUC-2 [Neurospora crassa] GI:1399532, xenotropic and polytropic murine leukemia virus receptor [Mus musculus castaneus] GI:6093320; contains Pfam profile PF03105: SPX domain Length = 287 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 458 LSDDSWEKTIGLIKHVTK 511 L DDSW+K +G+++ V K Sbjct: 270 LEDDSWKKKVGVLEQVAK 287 >At1g68670.1 68414.m07846 myb family transcription factor contains Pfam domain, PF00249: Myb-like DNA-binding domain Length = 354 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 328 RCSERTEGI-SLTVFETFLPLSPVGLLLQQLPDEQ 429 +CSE+T + VFE F+P+ + L +++ +E+ Sbjct: 63 QCSEQTTSVCGGPVFEEFIPIKKISSLCEEVQEEE 97 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,651,524 Number of Sequences: 28952 Number of extensions: 296360 Number of successful extensions: 867 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -