BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0481 (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0332 + 2621058-2621348,2621505-2622263 29 3.8 11_01_0632 - 5069425-5069441,5070656-5070809,5070889-5071050,507... 28 5.1 02_03_0236 + 16717320-16717496,16718082-16718240,16719410-167194... 28 6.7 01_01_0660 + 5029070-5029177,5029303-5029398,5029494-5029556,502... 28 6.7 05_07_0002 - 26979873-26980823 27 8.9 04_04_0355 - 24643036-24643308,24644084-24644320,24645051-246453... 27 8.9 >03_01_0332 + 2621058-2621348,2621505-2622263 Length = 349 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 606 IHQLLFYKQTPENYPPSG*GKVSKPAT 526 +HQ LF TP PP+G G S P T Sbjct: 30 MHQPLFNPTTPTTQPPNGNGSQSVPQT 56 >11_01_0632 - 5069425-5069441,5070656-5070809,5070889-5071050, 5071270-5072199 Length = 420 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 498 VDLTTDSNTRSPALRPYPSLREGSSLVSVYRTRADECG 611 V L DSN+++P L PSL E + V V +D CG Sbjct: 231 VSLQLDSNSKTPLLESMPSLAEAT--VRVTAGCSDVCG 266 >02_03_0236 + 16717320-16717496,16718082-16718240,16719410-16719472, 16720041-16720205,16721140-16721217,16721318-16721428, 16721516-16721632,16721713-16721808,16722592-16722662, 16722780-16723011 Length = 422 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 318 PSWNLFRPEIVRPFVKPVENETGRFFVQYN-NVPMGVEKVGDRLFITVPRRRYGI-PSTL 491 PSW+ + P V PFV +++ RF + + + P+ + D+L +P RR+ + P L Sbjct: 342 PSWSWYYPFYVAPFVSDLKSNC-RFEISFTVDKPL---RPFDQLMAVLPLRRHALSPFLL 397 Query: 492 NY 497 Y Sbjct: 398 LY 399 >01_01_0660 + 5029070-5029177,5029303-5029398,5029494-5029556, 5029836-5029913,5030446-5030614,5030797-5031180, 5031959-5032042,5032143-5032288,5032810-5033070, 5033147-5033328,5033421-5033586,5033650-5033703, 5034702-5034965,5035088-5035303,5035388-5035540, 5035630-5035827 Length = 873 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 321 SWNLFRPEIVRPFVKPVENETGRFFVQYNNVPMGVEKVGD 440 SW+ P++ RPF + R+ VQ++ +GV++V D Sbjct: 562 SWDSLPPDLARPF---SIGQQDRYNVQFDRPDLGVDEVKD 598 >05_07_0002 - 26979873-26980823 Length = 316 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 57 LLIDHQNEGFPVVF--LLAVTASGQLMSRKVGKLT 155 L I +NEG P + L +VTA G +++G+LT Sbjct: 169 LFIACRNEGMPRTYKELASVTAEGAAAKKEIGRLT 203 >04_04_0355 - 24643036-24643308,24644084-24644320,24645051-24645322, 24647675-24647778,24648207-24648334 Length = 337 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 267 RQDNRNQLSNRGDLPLRPSWNLFRPEIVRPF 359 R R +L RG+L L+P W + +I+ PF Sbjct: 24 RPGGRAELRLRGELVLQPVWEPWTRQIIVPF 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,269,604 Number of Sequences: 37544 Number of extensions: 266963 Number of successful extensions: 624 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -