BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0481 (611 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 62 1e-11 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 27 0.36 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 26 0.83 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 62.1 bits (144), Expect = 1e-11 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 10/90 (11%) Frame = +3 Query: 369 VENETGRFFVQYNNVPMGVEKVGDRLFITVPRRRYGIPSTLNYVDLTTDSNTRSPALRPY 548 ++ E G ++ N+PMG +R+F+ V RRR+GIPSTLN VDL+ + L+PY Sbjct: 41 LQRENG--YIPIGNIPMGAVHHKNRVFVAVARRRWGIPSTLNVVDLSPPFPNTNVILKPY 98 Query: 549 PS-----LR-----EGSSLVSVYRTRADEC 608 P+ LR + + +V+VYR R D C Sbjct: 99 PNFALNELRADLQPDANRIVTVYRPRVDRC 128 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 27.5 bits (58), Expect = 0.36 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +2 Query: 236 QKEETN*QRIQTRQSESAIKSRRSTPQAELESIQT--RNRETIREACRERNRK 388 Q+E ++ Q R+ E K R Q E E + R +E REA RER R+ Sbjct: 477 QREREQREKEQ-REKEQREKEERERQQREKEQREREQREKEREREAARERERE 528 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 26.2 bits (55), Expect = 0.83 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 278 SESAIKSRRSTPQAELESIQTRNRETIREACRERNRKIL 394 S S ++ TP A ++ T R E RER K+L Sbjct: 870 SPSMVRKALGTPTASRKTAGTLPRNDFEEMLRERREKVL 908 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,327 Number of Sequences: 2352 Number of extensions: 10533 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -