BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0479 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0233 + 1876940-1877509,1907940-1908195,1908290-1908589,190... 29 4.6 >08_01_0233 + 1876940-1877509,1907940-1908195,1908290-1908589, 1908777-1908939,1908958-1908994,1910122-1910742 Length = 648 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -1 Query: 456 IISVAPGFRLLTVTEFGPKAMWFEASILQLQRAPYREVNQD 334 ++ V R+ VTEF PK WFE + L L + +++++ Sbjct: 335 VLKVLHMVRIWEVTEFDPKMEWFEPTRLCLFNTAFFDLDKE 375 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,424,957 Number of Sequences: 37544 Number of extensions: 297832 Number of successful extensions: 698 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -