BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0477 (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25240.1 68415.m03020 serpin, putative / serine protease inhi... 52 4e-07 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 46 2e-05 At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 43 2e-04 At1g47710.1 68414.m05302 serpin, putative / serine protease inhi... 42 3e-04 At1g64030.1 68414.m07252 serpin family protein / serine protease... 40 0.002 At1g64010.1 68414.m07250 serpin, putative / serine protease inhi... 40 0.002 At1g62170.1 68414.m07013 serpin family protein / serine protease... 39 0.004 At2g14540.1 68415.m01628 serpin family protein / serine protease... 38 0.005 At2g35580.1 68415.m04357 serpin family protein / serine protease... 37 0.014 At3g11080.1 68416.m01339 disease resistance family protein conta... 29 2.8 At2g18860.1 68415.m02198 syntaxin family protein similar to Synt... 29 3.8 At1g72270.1 68414.m08355 expressed protein 29 3.8 At2g40720.1 68415.m05023 pentatricopeptide (PPR) repeat-containi... 28 6.6 At5g13350.1 68418.m01538 auxin-responsive GH3 family protein sim... 27 8.7 At4g24640.1 68417.m03528 invertase/pectin methylesterase inhibit... 27 8.7 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 27 8.7 At1g53360.1 68414.m06049 F-box family protein-related similar to... 27 8.7 At1g03000.1 68414.m00271 AAA-type ATPase family protein contains... 27 8.7 >At2g25240.1 68415.m03020 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 324 Score = 52.0 bits (119), Expect = 4e-07 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 4/68 (5%) Frame = +3 Query: 435 VYVDSVLHNVKITVNEFGTEAVAATAGILA----RSAEQFYADSPFYIFIRNEKTKLVTF 602 +YV S+LH I V+E GTEA A + G+++ R F AD PF +R +K+ ++ F Sbjct: 255 LYVSSILHKACIEVDEEGTEAAAVSVGVVSCTSFRRNPDFVADRPFLFTVREDKSGVILF 314 Query: 603 SAVVYDPT 626 V DP+ Sbjct: 315 MGQVLDPS 322 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 46.4 bits (105), Expect = 2e-05 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Frame = +3 Query: 435 VYVDSVLHNVKITVNEFGTEAVAATAGILARSA---EQFYADSPFYIFIRNEKTKLVTFS 605 ++V +V H I V+E GTEA A + + + F AD PF +R EK+ ++ F Sbjct: 325 LFVSNVFHKACIEVDEEGTEAAAVSVASMTKDMLLMGDFVADHPFLFTVREEKSGVILFM 384 Query: 606 AVVYDPTI 629 V DP+I Sbjct: 385 GQVLDPSI 392 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 4/68 (5%) Frame = +3 Query: 435 VYVDSVLHNVKITVNEFGTEAVAATAGILARSA----EQFYADSPFYIFIRNEKTKLVTF 602 ++V S++H I V+E GTEA A + I+ F AD PF +R + + ++ F Sbjct: 320 LHVSSIIHKACIEVDEEGTEAAAVSVAIMMPQCLMRNPDFVADHPFLFTVREDNSGVILF 379 Query: 603 SAVVYDPT 626 V DP+ Sbjct: 380 IGQVLDPS 387 >At1g47710.1 68414.m05302 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 391 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = +3 Query: 441 VDSVLHNVKITVNEFGTEAVAATAGI-------LARSAEQFYADSPFYIFIRNEKTKLVT 599 V ++ H I VNE GTEA AA+AG+ + F AD PF + + T +V Sbjct: 322 VSNIFHKACIEVNEEGTEAAAASAGVIKLRGLLMEEDEIDFVADHPFLLVVTENITGVVL 381 Query: 600 FSAVVYDP 623 F V DP Sbjct: 382 FIGQVVDP 389 >At1g64030.1 68414.m07252 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311, serpin [Triticum aestivum] GI:871551; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 385 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/69 (37%), Positives = 34/69 (49%), Gaps = 9/69 (13%) Frame = +3 Query: 447 SVLHNVKITVNEFGTEAVAATA-GILARSAE--------QFYADSPFYIFIRNEKTKLVT 599 S+ H + ++E G EA AATA G S + F AD PF IR EKT V Sbjct: 304 SMYHKACVEIDEEGAEAAAATADGDCGCSLDFVEPPKKIDFVADHPFLFLIREEKTGTVL 363 Query: 600 FSAVVYDPT 626 F ++DP+ Sbjct: 364 FVGQIFDPS 372 >At1g64010.1 68414.m07250 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 185 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = +3 Query: 468 ITVNEFGTEAVAATA-----GILARSAEQFYADSPFYIFIRNEKTKLVTFSAVVYDPT 626 + ++E G EA+AATA G F AD PF IR +KT V F ++DP+ Sbjct: 125 VEIDEEGAEAIAATAVVGGFGCAFVKRIDFVADHPFLFMIREDKTGTVLFVGQIFDPS 182 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 6/59 (10%) Frame = +3 Query: 468 ITVNEFGTEAVAATA------GILARSAEQFYADSPFYIFIRNEKTKLVTFSAVVYDPT 626 I ++E GTEAV TA G F AD PF IR E+T V F+ ++DP+ Sbjct: 374 IEIDEKGTEAVTFTAFRSAYLGCALVKPIDFVADHPFLFLIREEQTGTVLFAGQIFDPS 432 >At2g14540.1 68415.m01628 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 407 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 8/61 (13%) Frame = +3 Query: 468 ITVNEFGTEAVAATAGILA--------RSAEQFYADSPFYIFIRNEKTKLVTFSAVVYDP 623 I ++E GTEA AAT ++ + F AD PF IR +KT + F+ ++DP Sbjct: 338 IEIDEEGTEAAAATTVVVVTGSCLWEPKKKIDFVADHPFLFLIREDKTGTLLFAGQIFDP 397 Query: 624 T 626 + Sbjct: 398 S 398 >At2g35580.1 68415.m04357 serpin family protein / serine protease inhibitor family protein similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885350; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 374 Score = 36.7 bits (81), Expect = 0.014 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 6/70 (8%) Frame = +3 Query: 435 VYVDSVLHNVKITVNEFGTEAVAATA--GILAR----SAEQFYADSPFYIFIRNEKTKLV 596 V + ++H I V+E G++A AA A GI R F AD PF ++ ++ LV Sbjct: 303 VPLSMIMHKSCIEVDEVGSKAAAAAAFRGIGCRRPPPEKHDFVADHPFLFIVKEYRSGLV 362 Query: 597 TFSAVVYDPT 626 F V DP+ Sbjct: 363 LFLGQVMDPS 372 >At3g11080.1 68416.m01339 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 943 Score = 29.1 bits (62), Expect = 2.8 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 5/100 (5%) Frame = -2 Query: 499 TASVPNSLTVILTLCKTESTYTPGLGKLFNASFNI-----LDCS*PNLDLITTSFSFLSS 335 T ++PN+++++ L E++ G L ++ FNI LD S L+ T F +SS Sbjct: 306 TGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLN-GTLHFGNISS 364 Query: 334 DESIIKAKLASSGLNIDLIPTAFSALSRLTLLSKSILGNR 215 ++ + S+ I IP + S LTL S L + Sbjct: 365 PSNLQYLIIGSNNF-IGTIPRSLSRFVNLTLFDLSHLNTQ 403 >At2g18860.1 68415.m02198 syntaxin family protein similar to Syntaxin 61 (AtSYP61) (Osmotic stess-sensitive mutant 1) (Swiss-Prot:Q946Y7) [Arabidopsis thaliana] Length = 296 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/47 (25%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +3 Query: 228 MDLESNVNLDKALKAVGIKSMF-SPDEANFALMIDSSDDKKENEVVI 365 +D+E V +A K+VG++ ++ SP+ + +++ D+++E E ++ Sbjct: 183 IDIEERVTPGQAEKSVGLRRIWSSPNFNSLRIIVPGGDNEEEKETLV 229 >At1g72270.1 68414.m08355 expressed protein Length = 2777 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 340 SSDESIIKAKLASSGLNIDLIPTAFSALSRLTLLSKSILGN 218 ++ ESI+K + ++ DL T+FS L + L K+ LGN Sbjct: 1195 ATPESILKNFASVMAVSWDLYGTSFSFLLSIIFLEKNFLGN 1235 >At2g40720.1 68415.m05023 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 860 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 78 NDSTTVMYALKPRLPMKLSLFDLMKKLDYNKIDE 179 +D T V ++ PMK +F+++ +L N +DE Sbjct: 823 SDRTNVFFSGGSSSPMKAEIFNVLNRLKSNMVDE 856 >At5g13350.1 68418.m01538 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 587 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 540 FYADSPFYIFIRNEKTKLVTFSAVVYDPTI*KQFTTNKLL 659 FY +SP + F+ +K L A Y+ + K T KLL Sbjct: 415 FYNNSPHFRFVGRQKVVLSLHMANTYEEDLLKAVTNAKLL 454 >At4g24640.1 68417.m03528 invertase/pectin methylesterase inhibitor family protein annotation temporarily based on supporting cDNA gi|4097527|gb|U63898.1|U63898 Length = 187 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 264 LKAVGIKSMFSPDEANFALMIDSSDDKKENEVV 362 LK+ +K SPD AN+ + S ++ NE+V Sbjct: 112 LKSANVKLKASPDTANYDVRASSDSMRRVNELV 144 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/75 (24%), Positives = 35/75 (46%) Frame = +3 Query: 117 LPMKLSLFDLMKKLDYNKIDELINKMNERKAVVRFPKMDLESNVNLDKALKAVGIKSMFS 296 LP + + + +KL+Y ++ E + K E K ++ + DKAL+ + I + Sbjct: 506 LPSEDPVSERRRKLEYLEMQEELIKEEEEKEEEELTRIKDVKGGDEDKALQEMTIPTASE 565 Query: 297 PDEANFALMIDSSDD 341 E A +++ DD Sbjct: 566 AQEQARARVLEQQDD 580 >At1g53360.1 68414.m06049 F-box family protein-related similar to hypothetical protein GI:4589954 from [Arabidopsis thaliana]; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 343 Score = 27.5 bits (58), Expect = 8.7 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = +3 Query: 369 SRFGHEQSRMLKDALNSLPNPGVYV-DSVLHNVKITVNEFGTEAVAATAGILARSAEQFY 545 SR G +L+DA N + + + ++HN +I V GT G + S Y Sbjct: 244 SRNGELVLWVLEDAENHKWSKSICILPPIVHNSRI-VGVTGT-------GEIVFSPYACY 295 Query: 546 ADSPFYIFIRNEKTKLVT 599 SPFYIF N +TK T Sbjct: 296 MPSPFYIFFYNIQTKTCT 313 >At1g03000.1 68414.m00271 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family ('A'TPases 'A'ssociated with diverse cellular 'A'ctivities) Length = 941 Score = 27.5 bits (58), Expect = 8.7 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 2/95 (2%) Frame = +3 Query: 318 LMIDSSDDKKENEVVIRSRFGHE-QSRMLKDALNSLPNPGVYVDSVLHNVKITVNEFGTE 494 L+I S++ + IR F HE + L D S + V + I+ +EF Sbjct: 508 LLIASAESTEGISPTIRRCFSHEIRMGSLNDEQRS-EMLSQSLQGVSQFLNISSDEFMKG 566 Query: 495 AVAATAGILARSAEQFYADSPFYIFIRNE-KTKLV 596 V T+G L R + AD+ ++I E +TK + Sbjct: 567 LVGQTSGFLPRDLQALVADAGANLYISQESETKKI 601 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,829,585 Number of Sequences: 28952 Number of extensions: 244056 Number of successful extensions: 753 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -