BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0476 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 24 5.0 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 5.0 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 23.8 bits (49), Expect = 5.0 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -3 Query: 356 RYDAEMC---CMVTYVKQRPSASSTQRSVVALGRFDVRRCNF*SFFYFSVRVNVY*NT 192 RY+A C CM++++ + Q S A+ ++ N YF + NV +T Sbjct: 41 RYEAWYCAGECMISFLPKYEHTHVMQLSTSAIPCCSPKKMNSIRLLYFDMSYNVIYST 98 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 538 LIVLGGLVSIFIP*AFDGVKIFQYY 612 + V+ L+S F P F+ + I +YY Sbjct: 372 ITVVMSLISFFFPMIFEALGIIEYY 396 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,726 Number of Sequences: 2352 Number of extensions: 11401 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -