BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0473 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB21E7.04c ||SPAPB21E7.04c, SPAPB21E7.04c|S-adenosylmethionin... 27 3.5 SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 4.7 >SPBPB21E7.04c ||SPAPB21E7.04c, SPAPB21E7.04c|S-adenosylmethionine-dependent methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 281 Score = 26.6 bits (56), Expect = 3.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 161 RRSDIIQNLTPSLFFLPNIFIMKWKQILFSELQMAES 51 RRS + N+ PS +L +FI WK + +L++ E+ Sbjct: 164 RRS--LPNVIPSFEYLDFVFIDHWKDLYVPDLRVMET 198 >SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 26.2 bits (55), Expect = 4.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 344 DFYYDESIYLYVVCQSNILSQILTLY 267 + YY ES Y+ +VC I+ + +T + Sbjct: 36 ELYYGESFYINIVCSRPIVDENVTTW 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,924,842 Number of Sequences: 5004 Number of extensions: 62446 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -