BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0471 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 2.8 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 2.8 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/53 (20%), Positives = 23/53 (43%) Frame = -2 Query: 202 FS*IGELKLSESDSTRLVHGWYLFLIVIVCLLPCVRYAINEINVFMSIKVWSQ 44 F+ +G L + D L L + + +A+N N + ++ +W+Q Sbjct: 56 FAILGNLATNADDVNELTANTITTLFFTHSVTKFIYFAVNSENFYRTLAIWNQ 108 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/53 (20%), Positives = 23/53 (43%) Frame = -2 Query: 202 FS*IGELKLSESDSTRLVHGWYLFLIVIVCLLPCVRYAINEINVFMSIKVWSQ 44 F+ +G L + D L L + + +A+N N + ++ +W+Q Sbjct: 56 FAILGNLATNADDVNELTANTITTLFFTHSVTKFIYFAVNSENFYRTLAIWNQ 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,431 Number of Sequences: 2352 Number of extensions: 9208 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -