BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0471 (662 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001947-1|AAH01947.1| 341|Homo sapiens CD2 (cytoplasmic tail) ... 77 7e-14 BC000495-1|AAH00495.1| 341|Homo sapiens CD2 (cytoplasmic tail) ... 77 7e-14 AF104222-1|AAC84141.1| 341|Homo sapiens CD2 cytoplasmic domain ... 77 7e-14 >BC001947-1|AAH01947.1| 341|Homo sapiens CD2 (cytoplasmic tail) binding protein 2 protein. Length = 341 Score = 76.6 bits (180), Expect = 7e-14 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 432 PFNMKEELEEGHFDTQGHYHWKKEKEIRDGWLDNIDWVKVKGRPEDKYKIHHSDEK 599 PFN++EE+EEGHFD G+Y ++ +IRD WLDNIDWVK++ RP + + S+E+ Sbjct: 89 PFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASDSEEE 144 >BC000495-1|AAH00495.1| 341|Homo sapiens CD2 (cytoplasmic tail) binding protein 2 protein. Length = 341 Score = 76.6 bits (180), Expect = 7e-14 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 432 PFNMKEELEEGHFDTQGHYHWKKEKEIRDGWLDNIDWVKVKGRPEDKYKIHHSDEK 599 PFN++EE+EEGHFD G+Y ++ +IRD WLDNIDWVK++ RP + + S+E+ Sbjct: 89 PFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASDSEEE 144 >AF104222-1|AAC84141.1| 341|Homo sapiens CD2 cytoplasmic domain binding protein protein. Length = 341 Score = 76.6 bits (180), Expect = 7e-14 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 432 PFNMKEELEEGHFDTQGHYHWKKEKEIRDGWLDNIDWVKVKGRPEDKYKIHHSDEK 599 PFN++EE+EEGHFD G+Y ++ +IRD WLDNIDWVK++ RP + + S+E+ Sbjct: 89 PFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASDSEEE 144 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,889,914 Number of Sequences: 237096 Number of extensions: 1220578 Number of successful extensions: 13716 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13716 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -