BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0470 (640 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U71268-1|AAD00180.1| 575|Homo sapiens potential transcriptional... 31 3.4 U71267-1|AAD00179.1| 642|Homo sapiens potential transcriptional... 31 3.4 >U71268-1|AAD00180.1| 575|Homo sapiens potential transcriptional repressor NOT4Hp protein. Length = 575 Score = 31.1 bits (67), Expect = 3.4 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 535 NHSSNNHLYTTQYNLHHTQPQIFSVILVNN*TIGLGLINY-VTSKAL 398 NH +++H +QY+ T Q+ +++L+NN LG + VT KAL Sbjct: 369 NHRASSHQKQSQYHPLQTGKQLLALVLLNNQRDDLGFDPFDVTRKAL 415 >U71267-1|AAD00179.1| 642|Homo sapiens potential transcriptional repressor NOT4Hp protein. Length = 642 Score = 31.1 bits (67), Expect = 3.4 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -1 Query: 535 NHSSNNHLYTTQYNLHHTQPQIFSVILVNN*TIGLGLINY-VTSKAL 398 NH +++H +QY+ T Q+ +++L+NN LG + VT KAL Sbjct: 369 NHRASSHQKQSQYHPLQTGKQLLALVLLNNQRDDLGFDPFDVTRKAL 415 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,539,355 Number of Sequences: 237096 Number of extensions: 1345120 Number of successful extensions: 6066 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6066 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7028963750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -