BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0468 (534 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 0.73 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 5.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.8 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 6.8 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.8 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.8 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 24.2 bits (50), Expect = 0.73 Identities = 12/48 (25%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +1 Query: 220 EPSYDTAPLKAENIEVRDLAYD-DGTF---PPANVVDDWFEILRDKAE 351 EP+YD + + + + + + D +F P + +D+W + L++KA+ Sbjct: 378 EPTYDNSRREGKQLNPLNKGTEADSSFVTLPQLHSLDEWDDTLKEKAD 425 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.4 bits (43), Expect = 5.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 534 RSVLLQVRELLSVDGASTL 478 RS+ LQ++E L G S L Sbjct: 112 RSIYLQIKERLKTQGISHL 130 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = -1 Query: 342 ISEDLEPVVYDVGWREGPVVVGEVAHLD 259 +S+ + V+ + + +GP++ GEV +L+ Sbjct: 1162 VSQPSDEVMENSWFYDGPLIRGEVHYLN 1189 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = -1 Query: 342 ISEDLEPVVYDVGWREGPVVVGEVAHLD 259 +S+ + V+ + + +GP++ GEV +L+ Sbjct: 1162 VSQPSDEVMENSWFYDGPLIRGEVHYLN 1189 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.0 bits (42), Expect = 6.8 Identities = 7/29 (24%), Positives = 18/29 (62%) Frame = +1 Query: 445 KYEEAVETIRDQRRGAINAKQLSYLEKYR 531 KY++AVE + +++ ++ L++Y+ Sbjct: 46 KYQKAVEKLLTEQKELAEKEEAETLKRYK 74 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 6.8 Identities = 7/29 (24%), Positives = 18/29 (62%) Frame = +1 Query: 445 KYEEAVETIRDQRRGAINAKQLSYLEKYR 531 KY++AVE + +++ ++ L++Y+ Sbjct: 206 KYQKAVEKLLTEQKELAEKEEAETLKRYK 234 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 6.8 Identities = 7/29 (24%), Positives = 18/29 (62%) Frame = +1 Query: 445 KYEEAVETIRDQRRGAINAKQLSYLEKYR 531 KY++AVE + +++ ++ L++Y+ Sbjct: 206 KYQKAVEKLLTEQKELAEKEEAETLKRYK 234 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,349 Number of Sequences: 336 Number of extensions: 1691 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -