BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0466 (596 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 27 2.1 SPBC30D10.14 |||dienelactone hydrolase family|Schizosaccharomyce... 27 2.7 SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosacch... 26 3.6 SPAC57A7.07c |||homocysteine methyltransferase |Schizosaccharomy... 25 6.3 SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 25 6.3 SPAC9.12c |atp12||F1-ATPase chaperone Atp12 |Schizosaccharomyces... 25 6.3 SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pomb... 25 8.4 SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 25 8.4 SPAC17G6.10 |ssr1||SWI/SNF and RSC complex subunit Ssr1|Schizosa... 25 8.4 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 27.1 bits (57), Expect = 2.1 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +1 Query: 388 NSKQFFNIDKFINKIKSQFH 447 NSK +ID F+NK++S++H Sbjct: 853 NSKGKLSIDHFLNKVQSRWH 872 >SPBC30D10.14 |||dienelactone hydrolase family|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 26.6 bits (56), Expect = 2.7 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 160 NVTIGTYGRIWG 125 NVTIGTYG WG Sbjct: 130 NVTIGTYGFCWG 141 >SPBC13E7.01 |cwf22|SPBC15D4.16|splicing factor Cwf22|Schizosaccharomyces pombe|chr 2|||Manual Length = 834 Score = 26.2 bits (55), Expect = 3.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 340 LFLTRLISRLETSFQRNSK 396 L LTRLI + SFQRN K Sbjct: 193 LLLTRLIVQFRKSFQRNDK 211 >SPAC57A7.07c |||homocysteine methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 308 Score = 25.4 bits (53), Expect = 6.3 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 172 VEPPTVCLSNLTWINILFFIALVGRRAYGPPDGEWLPSPID 294 +EP LS+L NI + GR Y PDG + P D Sbjct: 223 LEPIAKMLSSLLPSNITAILYPDGRGLYQNPDGTFSPGSTD 263 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 25.4 bits (53), Expect = 6.3 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 145 FRLSHFLIHVEPPTVCLSNLTWINILFFIALVGRRAYGPP 264 F LSH L+ ++ P + + + ++ + LV R PP Sbjct: 1621 FLLSHLLLFLQAPVILIPYIDKLHSIILFWLVPSRQIRPP 1660 >SPAC9.12c |atp12||F1-ATPase chaperone Atp12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.4 bits (53), Expect = 6.3 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 495 RLPGTSINHVFIPSTTMELRFYFINEF-IDIKELLTIPLETRFESTN 358 RLP TS+ +P T++ R I++F + KELL+ L RF T+ Sbjct: 90 RLPSTSVRQHNLPITSLVSRAIDISQFKKEEKELLSTQL-IRFLDTD 135 >SPCC1919.05 |||TPR repeat protein Ski3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1389 Score = 25.0 bits (52), Expect = 8.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 146 NLWQDLGEAYAKAKQSLSMSNVYTNRMYLN 57 N W LGEAYA++ + +S + L+ Sbjct: 685 NAWSGLGEAYARSGRYVSALKAFNRASILD 714 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -3 Query: 594 DFFVTLVSHAM*HKKDSVNARGQRPAIAIRY 502 ++ + LV+ K + V A+GQ P+IA++Y Sbjct: 592 EYIINLVNRICMLKPNLVFAQGQIPSIALKY 622 >SPAC17G6.10 |ssr1||SWI/SNF and RSC complex subunit Ssr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 25.0 bits (52), Expect = 8.4 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 529 STPGDRDSLSNAASRNINQS 470 STP + SLSN NI+QS Sbjct: 212 STPNQKPSLSNLHENNIDQS 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,451,569 Number of Sequences: 5004 Number of extensions: 52564 Number of successful extensions: 117 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -