BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0463 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. 29 0.18 AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine pr... 29 0.18 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 2.9 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 8.9 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 8.9 >AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. Length = 380 Score = 28.7 bits (61), Expect = 0.18 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 177 AILGMRQFVHCLD*YSYFTTKHPYLEYRLQSYQLL 281 A GM + C+ + YFT HP+L Y L+ Q++ Sbjct: 336 AATGMIMMMRCMPMHPYFTVDHPFL-YVLRHQQMV 369 >AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine protease inhibitor protein. Length = 380 Score = 28.7 bits (61), Expect = 0.18 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 177 AILGMRQFVHCLD*YSYFTTKHPYLEYRLQSYQLL 281 A GM + C+ + YFT HP+L Y L+ Q++ Sbjct: 336 AATGMIMMMRCMPMHPYFTVDHPFL-YVLRHQQMV 369 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 24.6 bits (51), Expect = 2.9 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -3 Query: 482 SRGREFLTVGSGLALP 435 ++GRE+ VG+G+ALP Sbjct: 167 NQGREYTFVGNGVALP 182 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 385 PPDGEWLPSPMDFSNARG 438 PPD W P + F+NA G Sbjct: 104 PPDKVWKPDIVLFNNADG 121 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 391 DGEWLPSPMDFSNARGRAKP 450 DGEW P +D +G KP Sbjct: 255 DGEWEPPMIDNPEYKGEWKP 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,362 Number of Sequences: 2352 Number of extensions: 12829 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -