BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0461 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0304 - 16510406-16511353 29 4.6 08_01_0036 - 267236-268165,268255-268299,268485-268574,269485-26... 28 8.0 >09_04_0304 - 16510406-16511353 Length = 315 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 375 FVFYLSHFALFIVILYFYISKR 440 F +YLS +F+V LY Y+S R Sbjct: 248 FGWYLSFMTVFVVALYLYVSNR 269 >08_01_0036 - 267236-268165,268255-268299,268485-268574,269485-269805, 269895-270098,271532-271664,271810-271881,273106-273168, 273252-275034,275169-275217 Length = 1229 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +1 Query: 1 HEAPFKPKRITASQQKQAGWWYLPARTHKRSYHQ**YNKGIMCEGTGVVYLEY 159 H K ++ QQK+ G WY P+ + + ++ +MC+G Y Y Sbjct: 1116 HIRCLKTSQLAIEQQKKLGCWYCPSCLCRGCFQDKDDDQIVMCDGCDEGYHIY 1168 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,552,016 Number of Sequences: 37544 Number of extensions: 278647 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -