BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0460 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 25 0.66 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 25 0.66 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 25 0.66 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 25 0.66 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 24 1.1 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 24 1.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.0 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 8.1 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 8.1 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 25.0 bits (52), Expect = 0.66 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 303 PDHLTAPPTDPKFPP 259 P H++ DPKFPP Sbjct: 19 PQHISGVVVDPKFPP 33 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 25.0 bits (52), Expect = 0.66 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 303 PDHLTAPPTDPKFPP 259 P H++ DPKFPP Sbjct: 19 PQHISGVVVDPKFPP 33 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 25.0 bits (52), Expect = 0.66 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 303 PDHLTAPPTDPKFPP 259 P H++ DPKFPP Sbjct: 19 PQHISGVVVDPKFPP 33 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 25.0 bits (52), Expect = 0.66 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 303 PDHLTAPPTDPKFPP 259 P H++ DPKFPP Sbjct: 19 PQHISGVVVDPKFPP 33 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 509 FAYDVGDIPQTLLYGVLSHVPLEASQISGEVT 414 FA +G Q +Y V+ H P ++ +SG +T Sbjct: 8 FAMTLGQ--QNKMYNVIQHSPQQSIIVSGSIT 37 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 191 YPEQCHQIRQPQCQLYIPYS 250 YP +C I +P CQ Y P S Sbjct: 29 YPPRCPPIYEPSCQ-YSPVS 47 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 220 LPDLVALFRVSQVC*QVLSPGALITQYSVIFTTKNL 113 +P L +LFR S++C S + + ++F T+ L Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSHFLIVFFTETL 176 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 220 LPDLVALFRVSQVC*QVLSPGALITQYSVIFTTKNL 113 +P L +LFR S++C S + + ++F T+ L Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSHFLIVFFTETL 176 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 220 LPDLVALFRVSQVC*QVLSPGALITQYSVIFTTKNL 113 +P L +LFR S++C S + + ++F T+ L Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSHFLIVFFTETL 176 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 220 LPDLVALFRVSQVC*QVLSPGALITQYSVIFTTKNL 113 +P L +LFR S++C S + + ++F T+ L Sbjct: 141 VPQLGSLFRSSRMCFFKSSKKPAFSHFLIVFFTETL 176 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -1 Query: 453 CPIGSESNKWGGHCYWP 403 CP G N G C WP Sbjct: 138 CPNGLVYNDKAGICSWP 154 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.4 bits (43), Expect = 8.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 264 GTLDQLVGLSDDLGKLDT---FVEGVTRKVAQYLG 359 GT QL+ L D GKL F E +R++ G Sbjct: 104 GTTSQLIELLGDAGKLLASVHFAESQSRRILASAG 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,822 Number of Sequences: 336 Number of extensions: 3783 Number of successful extensions: 18 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -