BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0455 (710 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0457 - 3623163-3623172,3624806-3625183,3625316-3625332 30 1.6 06_03_0192 + 17755807-17755941,17756023-17756235,17758003-177580... 28 8.4 >05_01_0457 - 3623163-3623172,3624806-3625183,3625316-3625332 Length = 134 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 182 EWG-C*VLFSLRNFLIRSPRSKPAIKAIQ*LKTPQLRGHQNTSLERIKVTQIT 27 +W C +LF + + LI S+ ++ + +P LRG S+ R K+T++T Sbjct: 82 DWSLCEILFMVDDILIEKVHSRYLLRNLLKKWSPYLRGQSIYSITRTKLTRLT 134 >06_03_0192 + 17755807-17755941,17756023-17756235,17758003-17758086, 17759280-17759948 Length = 366 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 174 PPLRLPCSSRSTHSHVA 224 PPLRLPCSS S+ S A Sbjct: 11 PPLRLPCSSSSSPSPAA 27 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,420,557 Number of Sequences: 37544 Number of extensions: 294881 Number of successful extensions: 650 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -