BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0455 (710 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC103982-1|AAI03983.1| 337|Homo sapiens zinc finger, DHHC-type ... 30 7.1 BC103981-1|AAI03982.1| 337|Homo sapiens zinc finger, DHHC-type ... 30 7.1 BC103980-1|AAI03981.1| 337|Homo sapiens zinc finger, DHHC-type ... 30 7.1 AL137013-4|CAI40090.1| 337|Homo sapiens novel protein protein. 30 7.1 AK056374-1|BAB71168.1| 337|Homo sapiens protein ( Homo sapiens ... 30 7.1 >BC103982-1|AAI03983.1| 337|Homo sapiens zinc finger, DHHC-type containing 15 protein. Length = 337 Score = 30.3 bits (65), Expect = 7.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 292 ELTSVKGKVNVLLLLMFINMAWSYFIIIVLILNYYCLFI 408 EL SV+ K +VL LL +A +F+ +V++ Y+C + Sbjct: 203 ELPSVRSKFHVLFLLF---VACMFFVSLVILFGYHCWLV 238 >BC103981-1|AAI03982.1| 337|Homo sapiens zinc finger, DHHC-type containing 15 protein. Length = 337 Score = 30.3 bits (65), Expect = 7.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 292 ELTSVKGKVNVLLLLMFINMAWSYFIIIVLILNYYCLFI 408 EL SV+ K +VL LL +A +F+ +V++ Y+C + Sbjct: 203 ELPSVRSKFHVLFLLF---VACMFFVSLVILFGYHCWLV 238 >BC103980-1|AAI03981.1| 337|Homo sapiens zinc finger, DHHC-type containing 15 protein. Length = 337 Score = 30.3 bits (65), Expect = 7.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 292 ELTSVKGKVNVLLLLMFINMAWSYFIIIVLILNYYCLFI 408 EL SV+ K +VL LL +A +F+ +V++ Y+C + Sbjct: 203 ELPSVRSKFHVLFLLF---VACMFFVSLVILFGYHCWLV 238 >AL137013-4|CAI40090.1| 337|Homo sapiens novel protein protein. Length = 337 Score = 30.3 bits (65), Expect = 7.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 292 ELTSVKGKVNVLLLLMFINMAWSYFIIIVLILNYYCLFI 408 EL SV+ K +VL LL +A +F+ +V++ Y+C + Sbjct: 203 ELPSVRSKFHVLFLLF---VACMFFVSLVILFGYHCWLV 238 >AK056374-1|BAB71168.1| 337|Homo sapiens protein ( Homo sapiens cDNA FLJ31812 fis, clone NT2RI2009406, moderately similar to Homo sapiens rec mRNA. ). Length = 337 Score = 30.3 bits (65), Expect = 7.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +1 Query: 292 ELTSVKGKVNVLLLLMFINMAWSYFIIIVLILNYYCLFI 408 EL SV+ K +VL LL +A +F+ +V++ Y+C + Sbjct: 203 ELPSVRSKFHVLFLLF---VACMFFVSLVILFGYHCWLV 238 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,049,927 Number of Sequences: 237096 Number of extensions: 1710736 Number of successful extensions: 6490 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6490 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8287202872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -