BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0454 (692 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81115-6|CAD45598.1| 630|Caenorhabditis elegans Hypothetical pr... 28 7.3 AL032658-6|CAA21747.2| 630|Caenorhabditis elegans Hypothetical ... 28 7.3 Z81476-2|CAB03918.1| 1469|Caenorhabditis elegans Hypothetical pr... 27 9.6 >Z81115-6|CAD45598.1| 630|Caenorhabditis elegans Hypothetical protein Y76A2B.6 protein. Length = 630 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 222 EAIDECRSRTLSERRVSHQ*AKVM-VQGLAMLAAGFLSTSTSLPLCSVI 79 +++++ RS+ +++ VM + G ML GFL S SL LC I Sbjct: 475 DSLEQIRSQLYETESIAYTSCDVMMIIGAIMLLLGFLFLSFSLGLCDPI 523 >AL032658-6|CAA21747.2| 630|Caenorhabditis elegans Hypothetical protein Y76A2B.6 protein. Length = 630 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 222 EAIDECRSRTLSERRVSHQ*AKVM-VQGLAMLAAGFLSTSTSLPLCSVI 79 +++++ RS+ +++ VM + G ML GFL S SL LC I Sbjct: 475 DSLEQIRSQLYETESIAYTSCDVMMIIGAIMLLLGFLFLSFSLGLCDPI 523 >Z81476-2|CAB03918.1| 1469|Caenorhabditis elegans Hypothetical protein C25F9.2 protein. Length = 1469 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 593 RETTEKMLAHRCAGSY*IKTKDHLQKNH 676 R + L H C GSY K+ L+KNH Sbjct: 544 RRASNGQLKHVCGGSYCKICKEKLEKNH 571 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,445,984 Number of Sequences: 27780 Number of extensions: 271106 Number of successful extensions: 853 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -