SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0453
         (725 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974174-1|ABJ52814.1|  391|Anopheles gambiae serpin 18 protein.       25   1.8  
AF457558-1|AAL68788.1|   56|Anopheles gambiae hypothetical prote...    23   7.3  

>DQ974174-1|ABJ52814.1|  391|Anopheles gambiae serpin 18 protein.
          Length = 391

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -2

Query: 196 CLHNSLHCKVIS*SF 152
           CLHN L CKV+   F
Sbjct: 226 CLHNELRCKVVDMPF 240


>AF457558-1|AAL68788.1|   56|Anopheles gambiae hypothetical protein
           11 protein.
          Length = 56

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = -2

Query: 262 FFPSDCNTIYIYCAQMMQAKA*CLHNSLHCK 170
           F+ + C T Y++ A  ++AK+     + H K
Sbjct: 20  FYHTHCTTAYLWLAMGVEAKSIKARGTAHSK 50


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 612,692
Number of Sequences: 2352
Number of extensions: 12098
Number of successful extensions: 51
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 50
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74012934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -