BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0453 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. 25 1.8 AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical prote... 23 7.3 >DQ974174-1|ABJ52814.1| 391|Anopheles gambiae serpin 18 protein. Length = 391 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 196 CLHNSLHCKVIS*SF 152 CLHN L CKV+ F Sbjct: 226 CLHNELRCKVVDMPF 240 >AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical protein 11 protein. Length = 56 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -2 Query: 262 FFPSDCNTIYIYCAQMMQAKA*CLHNSLHCK 170 F+ + C T Y++ A ++AK+ + H K Sbjct: 20 FYHTHCTTAYLWLAMGVEAKSIKARGTAHSK 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,692 Number of Sequences: 2352 Number of extensions: 12098 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -