BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0453 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.9 S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating... 22 6.8 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.8 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +1 Query: 169 LYNATNYANIRLSLASFEHNICILYYSLKEKNYGS 273 L+N T Y ++ L H + LK++ Y S Sbjct: 234 LFNLTKYGKNQIKLLEIIHGLTKKVIQLKKEEYKS 268 >S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating peptide protein. Length = 50 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 382 MQTQFYCKKHASRPHI 429 M + CK+H +PHI Sbjct: 26 MSIKCNCKRHVIKPHI 41 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 528 GMSCSNSVLFFKQNK 484 G + SNS + FKQNK Sbjct: 149 GSNSSNSDVLFKQNK 163 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,457 Number of Sequences: 438 Number of extensions: 3360 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -