BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0449 (720 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F1DA2F Cluster: PREDICTED: hypothetical protein;... 35 2.3 UniRef50_Q47404 Cluster: Glycosyl transferase; n=4; Escherichia ... 35 2.3 UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD... 35 2.3 UniRef50_O96170 Cluster: Putative uncharacterized protein PFB037... 33 5.4 >UniRef50_UPI0000F1DA2F Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 132 Score = 34.7 bits (76), Expect = 2.3 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +1 Query: 439 SMMISYEIDTSCTVINHNVSSNNFRLYQYSKSLHLNISLCT 561 S+ + YE D SCT+I +NVS N+ LY + L +LC+ Sbjct: 86 SVTVDYEEDGSCTLILNNVSLNHSGLYSCKATNALGEALCS 126 >UniRef50_Q47404 Cluster: Glycosyl transferase; n=4; Escherichia coli|Rep: Glycosyl transferase - Escherichia coli Length = 409 Score = 34.7 bits (76), Expect = 2.3 Identities = 24/82 (29%), Positives = 42/82 (51%) Frame = -2 Query: 392 HLTEI*GQHSLYLPTCCVFYR*C*IIKGVNVMKVEIKLMSRKPSSKIRKTSKLHRFIYKE 213 HL + +Y P + Y+ C K ++ + IKL + + S K T +LH I K Sbjct: 331 HLIGLASSSLVYAP---LVYKEC---KTYSIAPIIIKLCNNEKSQKGINTLRLHFDILKN 384 Query: 212 YD*VPILHKDVVTLAINNKKDF 147 +D V IL D+ + ++++K+ F Sbjct: 385 FDNVKILSDDITSPSLHDKRIF 406 >UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD protein - Plasmodium falciparum Length = 960 Score = 34.7 bits (76), Expect = 2.3 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 484 NHNVSSNNFRLYQYSKSLHLNISLC--TLF*NYLKFNITN 597 N+ + +NN LYQY+K++ +N +L LF NY+ NI N Sbjct: 659 NYYIYNNNMNLYQYNKNILINNNLLYNKLFYNYINNNIYN 698 >UniRef50_O96170 Cluster: Putative uncharacterized protein PFB0375w; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFB0375w - Plasmodium falciparum (isolate 3D7) Length = 1802 Score = 33.5 bits (73), Expect = 5.4 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +1 Query: 448 ISYEIDTSCTVINHNVSSNNFRLYQYSKSLHLNISL-----CTLF*NYLKFNITNKI 603 I+Y+ DTS + N+ +N+ + Y + + N+ C + NY K+NI N I Sbjct: 1253 ITYKQDTSLDIDKENILNNSIKKYNIGSTYYYNMKCDKYGKCNKYDNYDKYNILNDI 1309 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,600,511 Number of Sequences: 1657284 Number of extensions: 10974868 Number of successful extensions: 21349 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21343 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 58264468239 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -