BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0449 (720 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1421 - 26961716-26963650,26967316-26967942,26969832-26970887 29 4.9 11_06_0588 + 25272067-25274850 28 6.5 >08_02_1421 - 26961716-26963650,26967316-26967942,26969832-26970887 Length = 1205 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 340 TQHVGRYRLCCPQISVKWKKRKCYDFQIV 426 T+HV RLC PQ SV + +K D QI+ Sbjct: 318 TEHVEVARLCVPQDSVPPEHKKLLDDQII 346 >11_06_0588 + 25272067-25274850 Length = 927 Score = 28.3 bits (60), Expect = 6.5 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 349 VGRYRLCCPQISVKWKKRKCYDFQIVLIIISMMISYEIDTS--CTVINHNVSSNNFRLYQ 522 VGR LC I K + C +V +I+ ++S DT+ TV+ + + + + Sbjct: 490 VGRLLLCPSDIDASGKVKTCTVLDLVHDVITDLVSGGYDTTFVVTVLAPRELARHLSI-R 548 Query: 523 YSKSLHLNIS 552 +S LH+++S Sbjct: 549 FSTKLHISLS 558 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,503,081 Number of Sequences: 37544 Number of extensions: 259706 Number of successful extensions: 417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -