BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0449 (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) 29 5.0 SB_30874| Best HMM Match : MTS (HMM E-Value=0.069) 28 8.8 >SB_38465| Best HMM Match : Nitrophorin (HMM E-Value=0.75) Length = 1167 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/45 (28%), Positives = 29/45 (64%) Frame = -2 Query: 308 VNVMKVEIKLMSRKPSSKIRKTSKLHRFIYKEYD*VPILHKDVVT 174 V++M++ ++ + P SK+ ++LH++ E +PI +++VVT Sbjct: 185 VSLMEMYLEDDNEVPYSKVHMKARLHQYFGNEKAIIPINNQNVVT 229 >SB_30874| Best HMM Match : MTS (HMM E-Value=0.069) Length = 233 Score = 27.9 bits (59), Expect = 8.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 94 RSHRCHNFNLKERFVSGLFEIRCHHL 17 R H+C + + +E + G I+CHHL Sbjct: 181 RLHKCRHLS-QESLIGGSVRIKCHHL 205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,165,399 Number of Sequences: 59808 Number of extensions: 337644 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -