BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0444 (486 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 5.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.0 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 7.0 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 9.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 9.2 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 9.2 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 9.2 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 9.2 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 187 TPRKVHKRMGKNKIHKRSKIKPF 255 +PR K + KN I ++++ PF Sbjct: 28 SPRTPIKNVYKNNIETKNQLSPF 50 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.0 Identities = 5/7 (71%), Positives = 7/7 (100%) Frame = +1 Query: 28 NIPPRWV 48 N+PPRW+ Sbjct: 676 NVPPRWI 682 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 124 ITTKVPPTSRTGMLSSLVSTGTP 192 IT + PP T VS GTP Sbjct: 608 ITIQEPPQWHTRSTEKRVSAGTP 630 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 20.6 bits (41), Expect = 9.2 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 259 KVVNYNHLMPTRYTVDFSFEKFSAKDLKDPA 351 K++ YN ++Y + S + + +KDPA Sbjct: 387 KILGYNLEAASKYQIVPSALEIFSTSMKDPA 417 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 20.6 bits (41), Expect = 9.2 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 259 KVVNYNHLMPTRYTVDFSFEKFSAKDLKDPA 351 K++ YN ++Y + S + + +KDPA Sbjct: 387 KILGYNLEAASKYQIVPSALEIFSTSMKDPA 417 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 20.6 bits (41), Expect = 9.2 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 256 VKVVNYNHLMPTRYTV 303 V V+N++H P RY + Sbjct: 344 VLVLNFHHRTPDRYVM 359 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 20.6 bits (41), Expect = 9.2 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 256 VKVVNYNHLMPTRYTV 303 V V+N++H P RY + Sbjct: 344 VLVLNFHHRTPDRYVM 359 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 20.6 bits (41), Expect = 9.2 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -1 Query: 60 ASLSYPSWRDIPLPSCRF 7 + L +P WR P P F Sbjct: 39 SDLVHPHWRAFPAPGKHF 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,911 Number of Sequences: 438 Number of extensions: 3255 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -