BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0442 (643 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0543 - 7039139-7039573 30 1.8 07_03_1243 + 25134422-25135201 28 5.5 >04_01_0543 - 7039139-7039573 Length = 144 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/57 (31%), Positives = 24/57 (42%) Frame = +1 Query: 376 QWLNIESGFMSPMSPPEMKPDTAMLDGFRDDSTXXXXXXXXXXXXXLSGSKHLCSIC 546 QW + G SP+ PP + P TA L G R +T L G+ + C C Sbjct: 3 QWRDGNGG-RSPLVPPPLSPPTAPLGGSRIVTTGHLQAALAMVGQPLDGNDNGCHRC 58 >07_03_1243 + 25134422-25135201 Length = 259 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Frame = +1 Query: 517 SGSKHLCSICGDRASG-KHYGVYSC-----EGCKGFFKRTV 621 S S+H+C IC + SG Y +C E C +FK T+ Sbjct: 24 SASRHVCDICEAKLSGLVGYRCNACDFDIHEACADYFKETI 64 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,083,270 Number of Sequences: 37544 Number of extensions: 265077 Number of successful extensions: 644 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 644 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -