BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0442 (643 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X52773-1|CAA36982.1| 462|Homo sapiens protein ( Human mRNA for ... 89 9e-18 DQ303444-1|ABB96254.1| 452|Homo sapiens retinoid X receptor, al... 89 9e-18 BC110998-1|AAI10999.1| 462|Homo sapiens retinoid X receptor, al... 89 9e-18 BC063827-1|AAH63827.1| 516|Homo sapiens RXRA protein protein. 89 9e-18 AL669970-1|CAM45733.1| 462|Homo sapiens retinoid X receptor, al... 89 9e-18 AL354796-1|CAH70571.1| 462|Homo sapiens retinoid X receptor, al... 89 9e-18 X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor ... 86 9e-17 M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta ... 86 9e-17 BT007280-1|AAP35944.1| 533|Homo sapiens retinoid X receptor, be... 86 9e-17 BC001167-1|AAH01167.1| 533|Homo sapiens retinoid X receptor, be... 86 9e-17 AL844527-9|CAI41836.2| 537|Homo sapiens retinoid X receptor, be... 86 9e-17 AL844527-8|CAI41837.1| 533|Homo sapiens retinoid X receptor, be... 86 9e-17 AL662824-21|CAI17612.2| 537|Homo sapiens retinoid X receptor, b... 86 9e-17 AL662824-20|CAI17614.1| 533|Homo sapiens retinoid X receptor, b... 86 9e-17 AL645940-7|CAI18064.2| 537|Homo sapiens retinoid X receptor, be... 86 9e-17 AL645940-6|CAI18066.1| 533|Homo sapiens retinoid X receptor, be... 86 9e-17 AL031228-14|CAI95622.1| 482|Homo sapiens retinoid X receptor, b... 86 9e-17 AL031228-13|CAA20239.1| 533|Homo sapiens retinoid X receptor, b... 86 9e-17 AL031228-12|CAI95621.1| 262|Homo sapiens retinoid X receptor, b... 86 9e-17 AF120161-1|AAD13794.1| 533|Homo sapiens retinoic X receptor bet... 86 9e-17 AF065396-1|AAC18599.1| 533|Homo sapiens retinoic X receptor B p... 86 9e-17 AB209244-1|BAD92481.1| 577|Homo sapiens retinoid X receptor, be... 86 9e-17 U38480-1|AAA80681.1| 463|Homo sapiens retinoid X receptor-gamma... 86 1e-16 CR456705-1|CAG32986.1| 463|Homo sapiens RXRG protein. 86 1e-16 BC012063-1|AAH12063.1| 463|Homo sapiens retinoid X receptor, ga... 86 1e-16 AL160058-2|CAC00596.1| 463|Homo sapiens retinoid X receptor, ga... 86 1e-16 U10990-1|AAC50118.1| 596|Homo sapiens hTAK1 protein. 72 2e-12 L27586-1|AAA21474.1| 615|Homo sapiens TR4 orphan receptor protein. 72 2e-12 BC051670-1|AAH51670.1| 530|Homo sapiens NR2C2 protein protein. 72 2e-12 Y13276-1|CAA73725.1| 385|Homo sapiens Tailless protein protein. 70 8e-12 M29960-1|AAA36761.1| 603|Homo sapiens protein ( Human steroid r... 70 8e-12 M29959-1|AAA36762.1| 467|Homo sapiens protein ( Human steroid r... 70 8e-12 M21985-1|AAA36650.1| 483|Homo sapiens protein ( Human steroid r... 70 8e-12 BC040141-1|AAH40141.1| 467|Homo sapiens nuclear receptor subfam... 70 8e-12 BC028031-1|AAH28031.1| 385|Homo sapiens nuclear receptor subfam... 70 8e-12 AL078596-2|CAO03480.1| 422|Homo sapiens nuclear receptor subfam... 70 8e-12 AL078596-1|CAB75626.1| 385|Homo sapiens nuclear receptor subfam... 70 8e-12 AK131541-1|BAD18677.1| 422|Homo sapiens protein ( Homo sapiens ... 70 8e-12 AF411525-1|AAL05871.1| 385|Homo sapiens nuclear receptor subfam... 70 8e-12 AF220532-1|AAG31945.1| 385|Homo sapiens orphan nuclear receptor... 70 8e-12 X12794-1|CAA31282.1| 403|Homo sapiens protein ( Human v-erbA re... 69 1e-11 Z49825-1|CAA89989.1| 504|Homo sapiens hepatocyte nuclear factor... 69 1e-11 X87872-1|CAA61135.1| 408|Homo sapiens Hepatocyte nuclear factor... 69 1e-11 X87871-1|CAA61134.1| 465|Homo sapiens Hepatocyte nuclear factor... 69 1e-11 X87870-1|CAA61133.1| 455|Homo sapiens Hepatocyte nuclear factor... 69 1e-11 X76930-1|CAA54248.1| 465|Homo sapiens hepatocyte nuclear factor... 69 1e-11 U72969-1|AAB48082.1| 516|Homo sapiens hepatocyte nuclear factor... 69 1e-11 U72967-1|AAB48083.1| 408|Homo sapiens hepatocyte nuclear factor... 69 1e-11 EF591040-1|ABQ52204.1| 474|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AY680698-1|AAT91239.1| 395|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AY680697-1|AAT91238.1| 452|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AY680696-1|AAT91237.1| 442|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AL132772-10|CAI18863.1| 100|Homo sapiens hepatocyte nuclear fac... 69 1e-11 AL132772-3|CAI18857.1| 467|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AL132772-2|CAC01303.1| 474|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AL132772-1|CAI18856.1| 417|Homo sapiens hepatocyte nuclear fact... 69 1e-11 AL117382-6|CAI23113.1| 100|Homo sapiens hepatocyte nuclear fact... 69 1e-11 CR542091-1|CAG46888.1| 408|Homo sapiens HNF4G protein. 69 2e-11 BC105011-1|AAI05012.1| 408|Homo sapiens HNF4G protein protein. 69 2e-11 BC105009-1|AAI05010.1| 408|Homo sapiens HNF4G protein protein. 69 2e-11 BC054009-1|AAH54009.1| 80|Homo sapiens HNF4G protein protein. 69 2e-11 BC084544-1|AAH84544.2| 404|Homo sapiens nuclear receptor subfam... 68 3e-11 BC063018-1|AAH63018.2| 404|Homo sapiens nuclear receptor subfam... 68 3e-11 BC002669-1|AAH02669.3| 404|Homo sapiens nuclear receptor subfam... 68 3e-11 X16155-1|CAA34277.1| 418|Homo sapiens COUP-TF protein. 67 4e-11 X12795-1|CAA31283.1| 423|Homo sapiens protein ( Human v-erbA re... 67 4e-11 BC017493-1|AAH17493.1| 423|Homo sapiens nuclear receptor subfam... 67 4e-11 BC004154-1|AAH04154.1| 423|Homo sapiens nuclear receptor subfam... 67 4e-11 Z49826-1|CAA89990.2| 408|Homo sapiens hepatocyte nuclear factor... 67 6e-11 S74349-1|AAB32649.1| 468|Homo sapiens peroxisome proliferator a... 67 6e-11 L02932-1|AAA36468.1| 468|Homo sapiens peroxisome proliferator a... 67 6e-11 CR457435-1|CAG33716.1| 468|Homo sapiens PPARA protein. 67 6e-11 CR456547-1|CAG30433.1| 468|Homo sapiens PPARA protein. 67 6e-11 BC000052-1|AAH00052.1| 258|Homo sapiens peroxisome proliferator... 67 6e-11 AY206718-1|AAO13489.1| 468|Homo sapiens peroxisome proliferativ... 67 6e-11 AL078611-2|CAI18764.1| 468|Homo sapiens peroxisome proliferativ... 67 6e-11 AL049856-1|CAI22450.1| 468|Homo sapiens peroxisome proliferativ... 67 6e-11 AF133504-1|AAF00110.1| 408|Homo sapiens hepatocyte nuclear fact... 67 6e-11 D49728-1|BAA08565.1| 598|Homo sapiens DNA binding protein protein. 66 1e-10 CR456704-1|CAG32985.1| 598|Homo sapiens NR4A1 protein. 66 1e-10 BT007144-1|AAP35808.1| 598|Homo sapiens nuclear receptor subfam... 66 1e-10 BC016147-1|AAH16147.1| 598|Homo sapiens nuclear receptor subfam... 66 1e-10 AK131566-1|BAD18699.1| 652|Homo sapiens protein ( Homo sapiens ... 66 1e-10 U60477-1|AAB09475.1| 414|Homo sapiens apoliprotein AI regulator... 66 1e-10 M64497-1|AAA86429.1| 414|Homo sapiens apolipoprotein AI regulat... 66 1e-10 M62760-1|AAA21479.1| 351|Homo sapiens ovalbumin upstream promot... 66 1e-10 L07592-1|AAA36469.1| 441|Homo sapiens peroxisome proliferator a... 66 1e-10 BC042897-1|AAH42897.1| 414|Homo sapiens nuclear receptor subfam... 66 1e-10 BC014664-1|AAH14664.1| 414|Homo sapiens nuclear receptor subfam... 66 1e-10 BC007578-1|AAH07578.1| 361|Homo sapiens PPARD protein protein. 66 1e-10 BC002715-1|AAH02715.1| 361|Homo sapiens PPARD protein protein. 66 1e-10 AY919140-1|AAX14041.1| 441|Homo sapiens peroxisome proliferator... 66 1e-10 AY442342-1|AAR05439.1| 441|Homo sapiens peroxisome proliferativ... 66 1e-10 AL022721-9|CAD92505.1| 361|Homo sapiens peroxisome proliferativ... 66 1e-10 AL022721-8|CAB38629.1| 441|Homo sapiens peroxisome proliferativ... 66 1e-10 AF246303-1|AAF62553.1| 441|Homo sapiens peroxisome proliferativ... 66 1e-10 AB099507-1|BAC78903.1| 161|Homo sapiens peroxisome proliferativ... 66 1e-10 X90563-2|CAA62153.1| 475|Homo sapiens peroxisome proliferator a... 65 2e-10 X90563-1|CAA62152.1| 477|Homo sapiens peroxisome proliferator a... 65 2e-10 U79012-1|AAC51248.1| 505|Homo sapiens ligand activated transcri... 65 2e-10 U63415-1|AAB04028.1| 505|Homo sapiens peroxisome proliferator a... 65 2e-10 M24898-1|AAA52335.1| 614|Homo sapiens triiodothyronine receptor... 65 2e-10 L40904-1|AAA80314.2| 477|Homo sapiens peroxisome proliferator a... 65 2e-10 D83233-1|BAA18949.1| 506|Homo sapiens PPAR gamma2 protein. 65 2e-10 DQ356894-1|ABC97372.1| 186|Homo sapiens peroxisome proliferativ... 65 2e-10 BT007281-1|AAP35945.1| 477|Homo sapiens peroxisome proliferativ... 65 2e-10 BC056148-1|AAH56148.1| 614|Homo sapiens nuclear receptor subfam... 65 2e-10 BC047875-1|AAH47875.1| 614|Homo sapiens nuclear receptor subfam... 65 2e-10 BC006811-1|AAH06811.1| 477|Homo sapiens peroxisome proliferator... 65 2e-10 AY222643-1|AAO66458.1| 584|Homo sapiens CREB3L2-PPARgamma protein. 65 2e-10 AY157024-1|AAN38992.2| 475|Homo sapiens peroxisome proliferativ... 65 2e-10 AK223528-1|BAD97248.1| 478|Homo sapiens peroxisome proliferativ... 65 2e-10 AJ698135-1|CAG29019.1| 248|Homo sapiens peroxisome proliferativ... 65 2e-10 AJ563370-1|CAD91389.1| 264|Homo sapiens peroxisome proliferativ... 65 2e-10 AJ563369-1|CAD91388.1| 280|Homo sapiens peroxisome proliferativ... 65 2e-10 AB005526-1|BAA23354.1| 474|Homo sapiens peroxisome proliferator... 65 2e-10 L31785-1|AAA65937.1| 579|Homo sapiens orphan nuclear hormone re... 65 2e-10 D16815-1|BAA20088.1| 579|Homo sapiens EAR-1r protein. 65 2e-10 CR457434-1|CAG33715.1| 579|Homo sapiens NR1D2 protein. 65 2e-10 BC070035-1|AAH70035.1| 408|Homo sapiens NR1D2 protein protein. 65 2e-10 BC045613-1|AAH45613.1| 579|Homo sapiens nuclear receptor subfam... 65 2e-10 AJ276674-1|CAB82769.1| 410|Homo sapiens photoreceptor-specific ... 65 2e-10 AF148128-1|AAF22227.1| 367|Homo sapiens nuclear receptor protein. 65 2e-10 AF121129-1|AAD28301.1| 410|Homo sapiens photoreceptor-specific ... 65 2e-10 AB209091-1|BAD92328.1| 549|Homo sapiens Orphan nuclear receptor... 65 2e-10 Y07619-1|CAA68898.1| 468|Homo sapiens peroxisome proliferator-a... 64 3e-10 X72631-1|CAB53540.1| 614|Homo sapiens Rev-ErbAalpha protein pro... 64 4e-10 X75918-1|CAA53518.1| 598|Homo sapiens NOT protein. 64 5e-10 S77154-1|AAB33999.1| 535|Homo sapiens TINUR protein. 64 5e-10 L13740-1|AAA36763.1| 598|Homo sapiens TR3 orphan receptor protein. 64 5e-10 BC066890-1|AAH66890.1| 535|Homo sapiens nuclear receptor subfam... 64 5e-10 BC009288-1|AAH09288.1| 598|Homo sapiens nuclear receptor subfam... 64 5e-10 AK223625-1|BAD97345.1| 598|Homo sapiens nuclear receptor subfam... 64 5e-10 AC074099-1|AAY24203.1| 598|Homo sapiens unknown protein. 64 5e-10 AB019433-1|BAA77328.1| 598|Homo sapiens T-cell nuclear receptor... 64 5e-10 AB017586-1|BAA75666.1| 598|Homo sapiens Nurr1 protein. 64 5e-10 X89894-1|CAA61984.1| 443|Homo sapiens nuclear receptor protein. 63 9e-10 U12767-1|AAB02581.1| 587|Homo sapiens mitogen induced nuclear o... 63 9e-10 S81243-1|AAB36006.1| 684|Homo sapiens CHN protein. 63 9e-10 D78579-1|BAA11419.1| 626|Homo sapiens neuron derived orphan rec... 63 9e-10 AL359710-3|CAI95139.1| 443|Homo sapiens nuclear receptor subfam... 63 9e-10 AL359710-2|CAI95138.1| 626|Homo sapiens nuclear receptor subfam... 63 9e-10 AL359710-1|CAM16648.1| 637|Homo sapiens nuclear receptor subfam... 63 9e-10 AL358937-4|CAI95320.1| 626|Homo sapiens nuclear receptor subfam... 63 9e-10 AL358937-3|CAM22558.1| 637|Homo sapiens nuclear receptor subfam... 63 9e-10 U64876-1|AAB06335.1| 480|Homo sapiens nuclear orphan receptor p... 62 1e-09 U22662-1|AAA85856.1| 447|Homo sapiens nuclear orphan receptor L... 62 1e-09 BT019411-1|AAV38218.1| 447|Homo sapiens nuclear receptor subfam... 62 1e-09 BC041172-1|AAH41172.1| 402|Homo sapiens NR1H3 protein protein. 62 1e-09 BC008819-1|AAH08819.1| 387|Homo sapiens NR1H3 protein protein. 62 1e-09 X51417-1|CAA35779.1| 433|Homo sapiens protein ( Human mRNA for ... 62 2e-09 BC131517-1|AAI31518.1| 503|Homo sapiens ESRRB protein protein. 62 2e-09 BC064700-1|AAH64700.1| 442|Homo sapiens ESRRG protein protein. 62 2e-09 BC008218-1|AAH08218.1| 343|Homo sapiens ESRRG protein protein. 62 2e-09 AY528719-1|AAS00098.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AY451390-1|AAS15572.1| 508|Homo sapiens estrogen receptor-relat... 62 2e-09 AY451389-1|AAS15571.1| 433|Homo sapiens estrogen receptor-relat... 62 2e-09 AY388461-1|AAQ93381.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AY388460-1|AAQ93380.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AY388459-1|AAQ93379.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AY388458-1|AAQ93378.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AY388457-1|AAQ93377.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AY388456-1|AAQ93376.1| 458|Homo sapiens estrogen-related recept... 62 2e-09 AL512650-2|CAH71595.1| 442|Homo sapiens estrogen-related recept... 62 2e-09 AL512650-1|CAH71594.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AL445650-2|CAH70619.1| 442|Homo sapiens estrogen-related recept... 62 2e-09 AL445650-1|CAH70618.1| 435|Homo sapiens estrogen-related recept... 62 2e-09 AF094518-1|AAC99410.1| 458|Homo sapiens nuclear receptor ERRG2 ... 62 2e-09 AF094517-1|AAC99409.1| 500|Homo sapiens nuclear receptor ERRB2 ... 62 2e-09 AC016543-1|AAG29619.1| 262|Homo sapiens hERRB2 protein. 62 2e-09 AB020639-1|BAA74855.2| 469|Homo sapiens KIAA0832 protein protein. 62 2e-09 X51416-1|CAA35778.1| 521|Homo sapiens protein ( Human mRNA for ... 61 3e-09 M57707-1|AAA63254.1| 454|Homo sapiens retinoic acid receptor-ga... 61 3e-09 M38258-1|AAA60254.1| 454|Homo sapiens retinoic acid receptor-ga... 61 3e-09 M24857-1|AAA52692.1| 454|Homo sapiens RARG protein. 61 3e-09 L38487-1|AAB17015.1| 481|Homo sapiens estrogen receptor-related... 61 3e-09 DQ514553-1|ABF47104.1| 423|Homo sapiens estrogen-related recept... 61 3e-09 BC093729-1|AAH93729.1| 454|Homo sapiens retinoic acid receptor,... 61 3e-09 BC093727-1|AAH93727.1| 454|Homo sapiens retinoic acid receptor,... 61 3e-09 BC093722-1|AAH93722.1| 423|Homo sapiens estrogen-related recept... 61 3e-09 BC093720-1|AAH93720.1| 423|Homo sapiens estrogen-related recept... 61 3e-09 BC092470-1|AAH92470.1| 423|Homo sapiens ESRRA protein protein. 61 3e-09 BC063795-1|AAH63795.2| 423|Homo sapiens estrogen-related recept... 61 3e-09 U68233-1|AAB08107.1| 472|Homo sapiens farnesol receptor HRR-1 p... 61 4e-09 U04899-1|AAA62660.1| 548|Homo sapiens RORalpha3 protein. 61 4e-09 U04898-1|AAA62659.1| 556|Homo sapiens RORalpha2 protein. 61 4e-09 U04897-1|AAA62658.1| 523|Homo sapiens RORalpha1 protein. 61 4e-09 L14611-1|AAA02963.1| 468|Homo sapiens transcription factor prot... 61 4e-09 BC130573-1|AAI30574.1| 476|Homo sapiens NR1H4 protein protein. 61 4e-09 BC100990-1|AAI00991.1| 468|Homo sapiens RAR-related orphan rece... 61 4e-09 BC100989-1|AAI00990.1| 468|Homo sapiens RAR-related orphan rece... 61 4e-09 BC100988-1|AAI00989.1| 468|Homo sapiens RAR-related orphan rece... 61 4e-09 BC100987-1|AAI00988.1| 468|Homo sapiens RAR-related orphan rece... 61 4e-09 BC071778-1|AAH71778.1| 475|Homo sapiens NR1H4 protein protein. 61 4e-09 BC008831-1|AAH08831.1| 523|Homo sapiens RAR-related orphan rece... 61 4e-09 AF478446-1|AAM53551.1| 486|Homo sapiens farnesoid-X-receptor be... 61 4e-09 AF478445-1|AAM53550.1| 482|Homo sapiens farnesoid-X-receptor be... 61 4e-09 AF384555-1|AAK60271.1| 476|Homo sapiens farnesol receptor protein. 61 4e-09 X99975-1|CAA68236.1| 480|Homo sapiens hRTR/hGCNF protein protein. 60 5e-09 U93553-1|AAD03155.1| 500|Homo sapiens alpha1-fetoprotein transc... 60 5e-09 U80802-1|AAB96828.1| 480|Homo sapiens orphan nuclear receptor G... 60 5e-09 U80251-1|AAC78727.1| 495|Homo sapiens hepatocytic transcription... 60 5e-09 S83309-1|AAB50876.1| 476|Homo sapiens germ cell nuclear factor ... 60 5e-09 BC118652-1|AAI18653.1| 495|Homo sapiens nuclear receptor subfam... 60 5e-09 BC118571-1|AAI18572.1| 495|Homo sapiens nuclear receptor subfam... 60 5e-09 BC030600-1|AAH30600.1| 475|Homo sapiens nuclear receptor subfam... 60 5e-09 AL354979-4|CAI10960.1| 479|Homo sapiens nuclear receptor subfam... 60 5e-09 AL354928-2|CAI39633.1| 479|Homo sapiens nuclear receptor subfam... 60 5e-09 AL158075-1|CAI13577.1| 479|Homo sapiens nuclear receptor subfam... 60 5e-09 AF190464-2|AAG17124.1| 495|Homo sapiens hepatocytic transcripti... 60 5e-09 AF190464-1|AAG17125.1| 541|Homo sapiens hepatocytic transcripti... 60 5e-09 AF146343-1|AAD37378.1| 495|Homo sapiens CYP7A promoter binding ... 60 5e-09 AF124247-1|AAD26565.1| 541|Homo sapiens hepatocytic transcripti... 60 5e-09 AF049102-1|AAD03248.1| 323|Homo sapiens alpha1-fetoprotein tran... 60 5e-09 AF004291-1|AAC52054.1| 454|Homo sapiens germ cell nuclear facto... 60 5e-09 AB019246-1|BAA34092.1| 541|Homo sapiens FTZ-F1 related protein ... 60 5e-09 AJ250835-1|CAB60726.1| 381|Homo sapiens retinoic acid receptor ... 60 7e-09 X99101-1|CAA67555.1| 477|Homo sapiens estrogen receptor beta pr... 60 9e-09 U76388-1|AAB53105.1| 461|Homo sapiens steroidogenic factor 1 pr... 60 9e-09 D88155-1|BAA13546.1| 461|Homo sapiens AdBP4 protein. 60 9e-09 DQ838583-1|ABH09190.1| 472|Homo sapiens estrogen receptor beta ... 60 9e-09 DQ838582-1|ABH09189.1| 481|Homo sapiens estrogen receptor beta ... 60 9e-09 DQ777076-1|ABG88022.1| 474|Homo sapiens estrogen receptor beta ... 60 9e-09 BC032501-1|AAH32501.1| 461|Homo sapiens nuclear receptor subfam... 60 9e-09 BC024181-1|AAH24181.1| 323|Homo sapiens ESR2 protein protein. 60 9e-09 AY785359-1|AAV31779.1| 530|Homo sapiens estrogen receptor 2 (ER... 60 9e-09 AY542548-1|AAS48621.1| 81|Homo sapiens nuclear receptor AdBP4 ... 60 9e-09 AL354979-3|CAI10959.1| 461|Homo sapiens nuclear receptor subfam... 60 9e-09 AL354979-2|CAI10958.1| 178|Homo sapiens nuclear receptor subfam... 60 9e-09 AL137846-2|CAI10872.1| 461|Homo sapiens nuclear receptor subfam... 60 9e-09 AF215937-2|AAG29940.1| 530|Homo sapiens 5p152 protein. 60 9e-09 AF124790-1|AAD32580.1| 323|Homo sapiens estrogen receptor beta2... 60 9e-09 AF074599-1|AAC25603.1| 381|Homo sapiens estrogen receptor beta ... 60 9e-09 AF060555-1|AAC15234.1| 513|Homo sapiens estrogen receptor beta ... 60 9e-09 AF051428-1|AAC05751.1| 495|Homo sapiens estrogen receptor beta2... 60 9e-09 AF051427-1|AAC05985.1| 530|Homo sapiens estrogen receptor beta ... 60 9e-09 AB209620-1|BAD92857.1| 504|Homo sapiens estrogen receptor 2 (ER... 60 9e-09 AB006590-1|BAA24953.1| 530|Homo sapiens estrogen receptor beta ... 60 9e-09 AB006589-1|BAA31966.1| 495|Homo sapiens estrogen receptor beta ... 60 9e-09 Y08639-1|CAA69929.1| 459|Homo sapiens nuclear orphan receptor R... 59 1e-08 X06614-1|CAA29829.1| 462|Homo sapiens protein ( Human mRNA for ... 59 1e-08 X06538-1|CAA29787.1| 432|Homo sapiens protein ( Human mRNA for ... 59 1e-08 U41743-1|AAB00113.1| 520|Homo sapiens nucleophosmin-retinoic ac... 59 1e-08 U41742-1|AAB00112.1| 563|Homo sapiens nucleophosmin-retinoic ac... 59 1e-08 U16997-1|AAA64751.1| 560|Homo sapiens ROR gamma protein. 59 1e-08 S50916-1|AAB19602.2| 416|Homo sapiens retinoic acid receptor al... 59 1e-08 M73779-1|AAA60126.1| 797|Homo sapiens PML-RAR protein protein. 59 1e-08 CR457438-1|CAG33719.1| 462|Homo sapiens RARA protein. 59 1e-08 CR457436-1|CAG33717.1| 518|Homo sapiens RORC protein. 59 1e-08 BC110571-1|AAI10572.1| 518|Homo sapiens RAR-related orphan rece... 59 1e-08 BC093774-1|AAH93774.1| 459|Homo sapiens RAR-related orphan rece... 59 1e-08 BC093772-1|AAH93772.1| 459|Homo sapiens RAR-related orphan rece... 59 1e-08 BC071733-1|AAH71733.1| 457|Homo sapiens retinoic acid receptor,... 59 1e-08 BC051830-1|AAH51830.1| 459|Homo sapiens RAR-related orphan rece... 59 1e-08 BC031554-1|AAH31554.1| 518|Homo sapiens RAR-related orphan rece... 59 1e-08 BC008727-1|AAH08727.1| 462|Homo sapiens retinoic acid receptor,... 59 1e-08 AL589765-18|CAI17180.1| 518|Homo sapiens RAR-related orphan rec... 59 1e-08 AL589765-17|CAI17179.1| 497|Homo sapiens RAR-related orphan rec... 59 1e-08 AL355674-1|CAD13280.2| 459|Homo sapiens RAR-related orphan rece... 59 1e-08 AL137018-1|CAD13276.2| 459|Homo sapiens RAR-related orphan rece... 59 1e-08 AK223137-1|BAD96857.1| 518|Homo sapiens RAR-related orphan rece... 59 1e-08 AF088895-1|AAD05222.1| 462|Homo sapiens retinoic acid receptor ... 59 1e-08 AF012304-1|AAC33511.1| 194|Homo sapiens nuclear mitotic apparat... 59 1e-08 Y00291-1|CAA68398.1| 448|Homo sapiens protein ( Human hap mRNA ... 59 2e-08 X07282-1|CAA30262.1| 448|Homo sapiens protein ( Human mRNA for ... 59 2e-08 X04707-1|CAA28412.1| 456|Homo sapiens put.thyroid hormone recep... 59 2e-08 M26747-1|AAA35677.1| 456|Homo sapiens c-erbA protein. 59 2e-08 DQ083391-1|AAZ32403.1| 184|Homo sapiens retinoic acid receptor ... 59 2e-08 BC106930-1|AAI06931.1| 461|Homo sapiens THRB protein protein. 59 2e-08 BC106929-1|AAI06930.1| 461|Homo sapiens thyroid hormone recepto... 59 2e-08 BC060794-1|AAH60794.1| 448|Homo sapiens retinoic acid receptor,... 59 2e-08 U14534-1|AAA58594.1| 455|Homo sapiens orphan receptor protein. 58 2e-08 U07132-1|AAA61783.1| 461|Homo sapiens Ner-I protein. 58 2e-08 CR456706-1|CAG32987.1| 461|Homo sapiens NR1H2 protein. 58 2e-08 BC074500-1|AAH74500.1| 461|Homo sapiens nuclear receptor subfam... 58 2e-08 BC047750-1|AAH47750.1| 461|Homo sapiens nuclear receptor subfam... 58 2e-08 BC033500-1|AAH33500.1| 461|Homo sapiens nuclear receptor subfam... 58 2e-08 BC007790-1|AAH07790.1| 461|Homo sapiens nuclear receptor subfam... 58 2e-08 Y00479-1|CAA68539.1| 490|Homo sapiens protein ( H.sapiens mRNA ... 57 5e-08 X55074-2|CAB57886.1| 490|Homo sapiens thyroid hormone receptor ... 57 5e-08 X55074-1|CAA38899.1| 410|Homo sapiens thyroid hormone receptor ... 57 5e-08 X55005-1|CAA38749.1| 410|Homo sapiens thyriod hormone receptor ... 57 5e-08 M24899-1|AAA35783.1| 490|Homo sapiens triiodothyronine receptor... 57 5e-08 M24748-2|AAA66021.1| 410|Homo sapiens thyroid receptor alpha-1 ... 57 5e-08 J03239-1|AAA61176.1| 490|Homo sapiens thyroid hormone receptor ... 57 5e-08 CR541915-1|CAG46713.1| 410|Homo sapiens THRA protein. 57 5e-08 BC035137-1|AAH35137.1| 451|Homo sapiens THRA protein protein. 57 5e-08 BC008851-1|AAH08851.1| 410|Homo sapiens THRA protein protein. 57 5e-08 BC002728-1|AAH02728.1| 490|Homo sapiens thyroid hormone recepto... 57 5e-08 BC000261-1|AAH00261.1| 490|Homo sapiens thyroid hormone recepto... 57 5e-08 AB209346-1|BAD92583.1| 397|Homo sapiens thyroid hormone recepto... 57 5e-08 M69297-1|AAA58462.1| 220|Homo sapiens estrogen receptor-related... 57 6e-08 X03635-2|CAA27284.1| 595|Homo sapiens oestrogen receptor protein. 56 8e-08 U47678-1|AAB00115.1| 701|Homo sapiens 80 kDa estrogen receptor ... 56 8e-08 M69296-1|AAA58461.1| 336|Homo sapiens estrogen receptor-related... 56 8e-08 M12674-1|AAA52399.1| 595|Homo sapiens ESR protein. 56 8e-08 EF614253-1|ABR09276.1| 473|Homo sapiens nuclear receptor subfam... 56 8e-08 DQ923326-1|ABJ52966.1| 397|Homo sapiens orphan nuclear receptor... 56 8e-08 DQ911122-1|ABJ52965.1| 434|Homo sapiens orphan nuclear receptor... 56 8e-08 BC128574-1|AAI28575.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 BC128573-1|AAI28574.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 BC017304-1|AAH17304.2| 433|Homo sapiens NR1I2 protein protein. 56 8e-08 AY425004-1|AAQ91815.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 AY091855-1|AAM26736.1| 434|Homo sapiens steroid and xenobiotic ... 56 8e-08 AL590993-1|CAI14237.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 AL356311-2|CAI21012.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 AL078582-4|CAI42285.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 AL049821-1|CAI22123.1| 595|Homo sapiens estrogen receptor 1 pro... 56 8e-08 AJ009937-2|CAB55493.1| 420|Homo sapiens nuclear hormone recepto... 56 8e-08 AJ009937-1|CAB55492.1| 397|Homo sapiens nuclear hormone recepto... 56 8e-08 AJ009936-2|CAB55490.1| 457|Homo sapiens nuclear hormone recepto... 56 8e-08 AJ009936-1|CAB55489.1| 434|Homo sapiens nuclear hormone recepto... 56 8e-08 AF364606-3|AAK38721.1| 397|Homo sapiens orphan nuclear receptor... 56 8e-08 AF364606-2|AAK38720.1| 434|Homo sapiens orphan nuclear receptor... 56 8e-08 AF364606-1|AAK38722.1| 473|Homo sapiens orphan nuclear receptor... 56 8e-08 AF123500-1|AAD52984.1| 444|Homo sapiens estrogen receptor alpha... 56 8e-08 AF084645-1|AAC64558.1| 434|Homo sapiens orphan nuclear receptor... 56 8e-08 AF084644-1|AAC64557.1| 473|Homo sapiens orphan nuclear receptor... 56 8e-08 AF061056-1|AAD05436.1| 434|Homo sapiens orphan nuclear receptor... 56 8e-08 AF058291-1|AAC39899.1| 436|Homo sapiens estrogen-related recept... 56 8e-08 D85245-1|BAA12746.1| 325|Homo sapiens TR3beta protein. 56 1e-07 Z30425-1|CAA83016.1| 348|Homo sapiens orphan nuclear hormone re... 55 2e-07 DQ022681-1|AAY56401.1| 357|Homo sapiens nuclear receptor subfam... 55 2e-07 BC121121-1|AAI21122.1| 309|Homo sapiens nuclear receptor subfam... 55 2e-07 BC121120-1|AAI21121.1| 314|Homo sapiens nuclear receptor subfam... 55 2e-07 BC069626-1|AAH69626.1| 352|Homo sapiens nuclear receptor subfam... 55 2e-07 AY572826-1|AAT47179.1| 119|Homo sapiens constitutive androstane... 55 2e-07 AY572823-1|AAT47176.1| 147|Homo sapiens constitutive androstane... 55 2e-07 AY572822-1|AAT47175.1| 147|Homo sapiens constitutive androstane... 55 2e-07 AY572819-1|AAT47172.1| 321|Homo sapiens constitutive androstane... 55 2e-07 AY572813-1|AAT47166.1| 278|Homo sapiens constitutive androstane... 55 2e-07 AY572810-1|AAT47163.1| 309|Homo sapiens constitutive androstane... 55 2e-07 AY572806-1|AAT47159.1| 322|Homo sapiens constitutive androstane... 55 2e-07 AL590714-14|CAH72154.1| 348|Homo sapiens nuclear receptor subfa... 55 2e-07 AL590714-13|CAH72153.1| 352|Homo sapiens nuclear receptor subfa... 55 2e-07 X67482-1|CAA47824.1| 427|Homo sapiens HL-60 1,25-dihydroxyvitam... 54 4e-07 J03258-1|AAA61273.1| 427|Homo sapiens VDR protein. 54 4e-07 BC060832-1|AAH60832.1| 427|Homo sapiens VDR protein protein. 54 4e-07 AY342401-1|AAP88938.1| 424|Homo sapiens vitamin D (1,25-dihydro... 54 4e-07 AF026260-1|AAB95155.1| 427|Homo sapiens vitamin D receptor prot... 54 4e-07 AB002168-1|BAA83389.1| 427|Homo sapiens vitamin D receptor prot... 54 4e-07 M65208-1|AAA61274.1| 67|Homo sapiens vitamin D receptor protein. 53 8e-07 M16801-1|AAA59571.1| 984|Homo sapiens MLR protein. 50 5e-06 BC111758-1|AAI11759.1| 867|Homo sapiens NR3C2 protein protein. 50 5e-06 AJ315514-1|CAC67405.1| 706|Homo sapiens mineralocorticoid recep... 50 5e-06 AF068623-1|AAC63513.1| 440|Homo sapiens mineralocorticoid recep... 50 5e-06 AB209056-1|BAD92293.1| 853|Homo sapiens nuclear receptor subfam... 50 5e-06 X51730-1|CAA36018.1| 933|Homo sapiens protein ( Human mRNA and ... 50 9e-06 M15716-1|AAA60081.1| 933|Homo sapiens progesterone receptor pro... 50 9e-06 AY525610-1|AAS00096.1| 933|Homo sapiens progesterone receptor p... 50 9e-06 AY382151-1|AAQ96833.1| 255|Homo sapiens progesterone receptor p... 50 9e-06 AF016381-1|AAD01587.1| 933|Homo sapiens progesterone receptor p... 50 9e-06 AC106889-1|AAY41033.1| 46|Homo sapiens unknown protein. 50 9e-06 AB085845-1|BAC11013.1| 803|Homo sapiens delta 6/2 progesterone ... 50 9e-06 AB085844-1|BAC11012.1| 690|Homo sapiens delta4+6/2 progesterone... 50 9e-06 AB085683-1|BAC06585.1| 695|Homo sapiens Progesterone receptor p... 50 9e-06 AB084248-1|BAB91074.1| 831|Homo sapiens delta 4 progesterone re... 50 9e-06 EF428110-1|ABR57508.1| 146|Homo sapiens protein kinase A regula... 49 1e-05 X03348-1|CAA27054.1| 742|Homo sapiens beta-glucocorticoid recep... 49 2e-05 X03225-1|CAA26976.1| 777|Homo sapiens alpha-glucocorticoid rece... 49 2e-05 U80947-1|AAB64354.1| 742|Homo sapiens glucocorticoid receptor b... 49 2e-05 U80946-1|AAB64353.1| 777|Homo sapiens glucocorticoid receptor a... 49 2e-05 BC015610-1|AAH15610.1| 777|Homo sapiens nuclear receptor subfam... 49 2e-05 AY436590-1|AAQ97180.1| 777|Homo sapiens nuclear receptor subfam... 49 2e-05 AM183262-1|CAJ65924.1| 751|Homo sapiens glucocorticoid receptor... 49 2e-05 AK223594-1|BAD97314.1| 777|Homo sapiens nuclear receptor subfam... 49 2e-05 AC005601-1|AAC34207.1| 235|Homo sapiens glucocorticoid receptor... 49 2e-05 AB085843-1|BAC11011.1| 764|Homo sapiens delta 3+6/2 progesteron... 49 2e-05 U01351-2|AAA16603.1| 778|Homo sapiens glucocorticoid receptor a... 48 3e-05 D85242-1|BAA31221.1| 143|Homo sapiens NOR-1 3'-variant protein. 48 4e-05 M20260-1|AAA51774.1| 452|Homo sapiens AR protein. 47 5e-05 M73069-1|AAA51735.1| 730|Homo sapiens androgen receptor protein. 46 9e-05 M35851-1|AAA51772.1| 917|Homo sapiens androgen receptor protein. 46 9e-05 M34233-1|AAA51780.1| 906|Homo sapiens AR protein. 46 9e-05 M27430-1|AAA51886.1| 919|Homo sapiens AR protein. 46 9e-05 M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. 46 9e-05 M21748-1|AAA51771.1| 917|Homo sapiens androgen receptor protein. 46 9e-05 M20132-1|AAA51729.1| 919|Homo sapiens AR protein. 46 9e-05 L29496-1|AAA51770.1| 734|Homo sapiens AR protein. 46 9e-05 BC132975-1|AAI32976.1| 914|Homo sapiens AR protein protein. 46 9e-05 AL356358-1|CAI40496.1| 920|Homo sapiens androgen receptor (dihy... 46 9e-05 AL158016-1|CAI40853.1| 920|Homo sapiens androgen receptor (dihy... 46 9e-05 AL049564-2|CAI43080.1| 920|Homo sapiens androgen receptor (dihy... 46 9e-05 AF162704-1|AAD45921.1| 906|Homo sapiens androgen receptor protein. 46 9e-05 U32592-1|AAA75332.1| 56|Homo sapiens steroidogenic factor 1 pr... 44 3e-04 X04014-1|CAA27637.1| 173|Homo sapiens hypothetical protein prot... 44 6e-04 AB009577-1|BAB18655.1| 34|Homo sapiens Ad4BP protein. 43 0.001 M57445-1|AAA58728.1| 49|Homo sapiens retinoic acid receptor pr... 41 0.003 S82307-1|AAB47194.2| 133|Homo sapiens p65 protein. 36 0.12 AJ002425-1|CAA05410.2| 614|Homo sapiens protein protein. 36 0.12 AJ009937-3|CAB55494.1| 342|Homo sapiens nuclear hormone recepto... 31 4.6 AJ009936-3|CAB55491.1| 379|Homo sapiens nuclear hormone recepto... 31 4.6 >X52773-1|CAA36982.1| 462|Homo sapiens protein ( Human mRNA for retinoic acid receptor-like protein. ). Length = 462 Score = 89.4 bits (212), Expect = 9e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDLTY Sbjct: 129 SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTY 169 >DQ303444-1|ABB96254.1| 452|Homo sapiens retinoid X receptor, alpha protein. Length = 452 Score = 89.4 bits (212), Expect = 9e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDLTY Sbjct: 119 SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTY 159 >BC110998-1|AAI10999.1| 462|Homo sapiens retinoid X receptor, alpha protein. Length = 462 Score = 89.4 bits (212), Expect = 9e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDLTY Sbjct: 129 SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTY 169 >BC063827-1|AAH63827.1| 516|Homo sapiens RXRA protein protein. Length = 516 Score = 89.4 bits (212), Expect = 9e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDLTY Sbjct: 183 SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTY 223 >AL669970-1|CAM45733.1| 462|Homo sapiens retinoid X receptor, alpha protein. Length = 462 Score = 89.4 bits (212), Expect = 9e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDLTY Sbjct: 129 SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTY 169 >AL354796-1|CAH70571.1| 462|Homo sapiens retinoid X receptor, alpha protein. Length = 462 Score = 89.4 bits (212), Expect = 9e-18 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S +KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRTVRKDLTY Sbjct: 129 SFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTY 169 >X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor b protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >BT007280-1|AAP35944.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >BC001167-1|AAH01167.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL844527-9|CAI41836.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL844527-8|CAI41837.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL662824-21|CAI17612.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL662824-20|CAI17614.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL645940-7|CAI18064.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL645940-6|CAI18066.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL031228-14|CAI95622.1| 482|Homo sapiens retinoid X receptor, beta protein. Length = 482 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 151 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 189 >AL031228-13|CAA20239.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AL031228-12|CAI95621.1| 262|Homo sapiens retinoid X receptor, beta protein. Length = 262 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 173 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 211 >AF120161-1|AAD13794.1| 533|Homo sapiens retinoic X receptor beta protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AF065396-1|AAC18599.1| 533|Homo sapiens retinoic X receptor B protein. Length = 533 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 202 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 240 >AB209244-1|BAD92481.1| 577|Homo sapiens retinoid X receptor, beta variant protein. Length = 577 Score = 86.2 bits (204), Expect = 9e-17 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDLTY+ Sbjct: 242 KRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS 280 >U38480-1|AAA80681.1| 463|Homo sapiens retinoid X receptor-gamma protein. Length = 463 Score = 85.8 bits (203), Expect = 1e-16 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDL Y Sbjct: 136 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIY 173 >CR456705-1|CAG32986.1| 463|Homo sapiens RXRG protein. Length = 463 Score = 85.8 bits (203), Expect = 1e-16 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDL Y Sbjct: 136 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIY 173 >BC012063-1|AAH12063.1| 463|Homo sapiens retinoid X receptor, gamma protein. Length = 463 Score = 85.8 bits (203), Expect = 1e-16 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDL Y Sbjct: 136 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIY 173 >AL160058-2|CAC00596.1| 463|Homo sapiens retinoid X receptor, gamma protein. Length = 463 Score = 85.8 bits (203), Expect = 1e-16 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 KH+C+ICGDR+SGKHYGVYSCEGCKGFFKRT+RKDL Y Sbjct: 136 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIY 173 >U10990-1|AAC50118.1| 596|Homo sapiens hTAK1 protein. Length = 596 Score = 71.7 bits (168), Expect = 2e-12 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C +CGD+ASG+HYG SCEGCKGFFKR+VRK+LTY+ Sbjct: 117 CVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYS 152 >L27586-1|AAA21474.1| 615|Homo sapiens TR4 orphan receptor protein. Length = 615 Score = 71.7 bits (168), Expect = 2e-12 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C +CGD+ASG+HYG SCEGCKGFFKR+VRK+LTY+ Sbjct: 136 CVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYS 171 >BC051670-1|AAH51670.1| 530|Homo sapiens NR2C2 protein protein. Length = 530 Score = 71.7 bits (168), Expect = 2e-12 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C +CGD+ASG+HYG SCEGCKGFFKR+VRK+LTY+ Sbjct: 136 CVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYS 171 >Y13276-1|CAA73725.1| 385|Homo sapiens Tailless protein protein. Length = 385 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 16 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 50 >M29960-1|AAA36761.1| 603|Homo sapiens protein ( Human steroid receptor (TR2-11) mRNA, complete cds. ). Length = 603 Score = 69.7 bits (163), Expect = 8e-12 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 LC +CGD+ASG+HYG +CEGCKGFFKR++RK+L Y+ Sbjct: 112 LCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYS 148 >M29959-1|AAA36762.1| 467|Homo sapiens protein ( Human steroid receptor (TR2-9) mRNA, complete cds. ). Length = 467 Score = 69.7 bits (163), Expect = 8e-12 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 LC +CGD+ASG+HYG +CEGCKGFFKR++RK+L Y+ Sbjct: 112 LCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYS 148 >M21985-1|AAA36650.1| 483|Homo sapiens protein ( Human steroid receptor TR2 mRNA, complete cds. ). Length = 483 Score = 69.7 bits (163), Expect = 8e-12 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 LC +CGD+ASG+HYG +CEGCKGFFKR++RK+L Y+ Sbjct: 112 LCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYS 148 >BC040141-1|AAH40141.1| 467|Homo sapiens nuclear receptor subfamily 2, group C, member 1 protein. Length = 467 Score = 69.7 bits (163), Expect = 8e-12 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 LC +CGD+ASG+HYG +CEGCKGFFKR++RK+L Y+ Sbjct: 112 LCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYS 148 >BC028031-1|AAH28031.1| 385|Homo sapiens nuclear receptor subfamily 2, group E, member 1 protein. Length = 385 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 16 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 50 >AL078596-2|CAO03480.1| 422|Homo sapiens nuclear receptor subfamily 2, group E, member 1 protein. Length = 422 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 53 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 87 >AL078596-1|CAB75626.1| 385|Homo sapiens nuclear receptor subfamily 2, group E, member 1 protein. Length = 385 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 16 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 50 >AK131541-1|BAD18677.1| 422|Homo sapiens protein ( Homo sapiens cDNA FLJ16774 fis, clone BRCAN2019772, highly similar to Orphan nuclear receptor NR2E1. ). Length = 422 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 53 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 87 >AF411525-1|AAL05871.1| 385|Homo sapiens nuclear receptor subfamily 2 group E member 1 protein. Length = 385 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 16 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 50 >AF220532-1|AAG31945.1| 385|Homo sapiens orphan nuclear receptor protein. Length = 385 Score = 69.7 bits (163), Expect = 8e-12 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGDR+SGKHYGVY+C+GC GFFKR++R++ TY Sbjct: 16 CKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY 50 >X12794-1|CAA31282.1| 403|Homo sapiens protein ( Human v-erbA related ear-2 gene. ). Length = 403 Score = 69.3 bits (162), Expect = 1e-11 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYGV++CEGCK FFKRT+R++L+Y Sbjct: 56 CVVCGDKSSGKHYGVFTCEGCKSFFKRTIRRNLSY 90 >Z49825-1|CAA89989.1| 504|Homo sapiens hepatocyte nuclear factor 4 alpha (HNF4alpha4) protein. Length = 504 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 85 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 125 >X87872-1|CAA61135.1| 408|Homo sapiens Hepatocyte nuclear factor 4C protein. Length = 408 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 46 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 86 >X87871-1|CAA61134.1| 465|Homo sapiens Hepatocyte nuclear factor 4B protein. Length = 465 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 46 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 86 >X87870-1|CAA61133.1| 455|Homo sapiens Hepatocyte nuclear factor 4A protein. Length = 455 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 46 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 86 >X76930-1|CAA54248.1| 465|Homo sapiens hepatocyte nuclear factor 4 protein. Length = 465 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 46 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 86 >U72969-1|AAB48082.1| 516|Homo sapiens hepatocyte nuclear factor 4-alpha protein. Length = 516 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 97 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 137 >U72967-1|AAB48083.1| 408|Homo sapiens hepatocyte nuclear factor 4-alpha protein. Length = 408 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 46 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 86 >EF591040-1|ABQ52204.1| 474|Homo sapiens hepatocyte nuclear factor 4, alpha protein. Length = 474 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 55 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 95 >AY680698-1|AAT91239.1| 395|Homo sapiens hepatocyte nuclear factor 4 alpha, transcript variant 9 protein. Length = 395 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 33 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 73 >AY680697-1|AAT91238.1| 452|Homo sapiens hepatocyte nuclear factor 4 alpha, transcript variant 8 protein. Length = 452 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 33 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 73 >AY680696-1|AAT91237.1| 442|Homo sapiens hepatocyte nuclear factor 4 alpha, transcript variant 7 protein. Length = 442 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 33 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 73 >AL132772-10|CAI18863.1| 100|Homo sapiens hepatocyte nuclear factor 4, alpha protein. Length = 100 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 33 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 73 >AL132772-3|CAI18857.1| 467|Homo sapiens hepatocyte nuclear factor 4, alpha protein. Length = 467 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 48 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 88 >AL132772-2|CAC01303.1| 474|Homo sapiens hepatocyte nuclear factor 4, alpha protein. Length = 474 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 55 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 95 >AL132772-1|CAI18856.1| 417|Homo sapiens hepatocyte nuclear factor 4, alpha protein. Length = 417 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 55 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 95 >AL117382-6|CAI23113.1| 100|Homo sapiens hepatocyte nuclear factor 4, alpha protein. Length = 100 Score = 68.9 bits (161), Expect = 1e-11 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 G LC+ICGDRA+GKHYG SC+GCKGFF+R+VRK+ Y+ Sbjct: 33 GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS 73 >CR542091-1|CAG46888.1| 408|Homo sapiens HNF4G protein. Length = 408 Score = 68.5 bits (160), Expect = 2e-11 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 +G LC+ICGDRA+GKHYG SC+GCKGFF+R++RK Y+ Sbjct: 6 NGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYS 47 >BC105011-1|AAI05012.1| 408|Homo sapiens HNF4G protein protein. Length = 408 Score = 68.5 bits (160), Expect = 2e-11 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 +G LC+ICGDRA+GKHYG SC+GCKGFF+R++RK Y+ Sbjct: 6 NGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYS 47 >BC105009-1|AAI05010.1| 408|Homo sapiens HNF4G protein protein. Length = 408 Score = 68.5 bits (160), Expect = 2e-11 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 +G LC+ICGDRA+GKHYG SC+GCKGFF+R++RK Y+ Sbjct: 6 NGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYS 47 >BC054009-1|AAH54009.1| 80|Homo sapiens HNF4G protein protein. Length = 80 Score = 68.5 bits (160), Expect = 2e-11 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 +G LC+ICGDRA+GKHYG SC+GCKGFF+R++RK Y+ Sbjct: 6 NGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYS 47 >BC084544-1|AAH84544.2| 404|Homo sapiens nuclear receptor subfamily 2, group F, member 6 protein. Length = 404 Score = 67.7 bits (158), Expect = 3e-11 Identities = 23/35 (65%), Positives = 33/35 (94%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYGV++CEGCK FFKR++R++L+Y Sbjct: 56 CVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSY 90 >BC063018-1|AAH63018.2| 404|Homo sapiens nuclear receptor subfamily 2, group F, member 6 protein. Length = 404 Score = 67.7 bits (158), Expect = 3e-11 Identities = 23/35 (65%), Positives = 33/35 (94%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYGV++CEGCK FFKR++R++L+Y Sbjct: 56 CVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSY 90 >BC002669-1|AAH02669.3| 404|Homo sapiens nuclear receptor subfamily 2, group F, member 6 protein. Length = 404 Score = 67.7 bits (158), Expect = 3e-11 Identities = 23/35 (65%), Positives = 33/35 (94%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYGV++CEGCK FFKR++R++L+Y Sbjct: 56 CVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSY 90 >X16155-1|CAA34277.1| 418|Homo sapiens COUP-TF protein. Length = 418 Score = 67.3 bits (157), Expect = 4e-11 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++LTY Sbjct: 81 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY 115 >X12795-1|CAA31283.1| 423|Homo sapiens protein ( Human v-erbA related ear-3 gene. ). Length = 423 Score = 67.3 bits (157), Expect = 4e-11 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++LTY Sbjct: 86 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY 120 >BC017493-1|AAH17493.1| 423|Homo sapiens nuclear receptor subfamily 2, group F, member 1 protein. Length = 423 Score = 67.3 bits (157), Expect = 4e-11 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++LTY Sbjct: 86 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY 120 >BC004154-1|AAH04154.1| 423|Homo sapiens nuclear receptor subfamily 2, group F, member 1 protein. Length = 423 Score = 67.3 bits (157), Expect = 4e-11 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++LTY Sbjct: 86 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY 120 >Z49826-1|CAA89990.2| 408|Homo sapiens hepatocyte nuclear factor 4 gamma (HNF4gamma) protein. Length = 408 Score = 66.9 bits (156), Expect = 6e-11 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 +G LC+ICGDRA+GKHYG +C+GCKGFF+R++RK Y+ Sbjct: 6 NGVNCLCAICGDRATGKHYGASTCDGCKGFFRRSIRKSHIYS 47 >S74349-1|AAB32649.1| 468|Homo sapiens peroxisome proliferator activated receptor alpha protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >L02932-1|AAA36468.1| 468|Homo sapiens peroxisome proliferator activated receptor protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >CR457435-1|CAG33716.1| 468|Homo sapiens PPARA protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >CR456547-1|CAG30433.1| 468|Homo sapiens PPARA protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >BC000052-1|AAH00052.1| 258|Homo sapiens peroxisome proliferator-activated receptor alpha protein. Length = 258 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >AY206718-1|AAO13489.1| 468|Homo sapiens peroxisome proliferative activated receptor, alpha protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >AL078611-2|CAI18764.1| 468|Homo sapiens peroxisome proliferative activated receptor, alpha protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >AL049856-1|CAI22450.1| 468|Homo sapiens peroxisome proliferative activated receptor, alpha protein. Length = 468 Score = 66.9 bits (156), Expect = 6e-11 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVY 136 >AF133504-1|AAF00110.1| 408|Homo sapiens hepatocyte nuclear factor 4 gamma protein. Length = 408 Score = 66.9 bits (156), Expect = 6e-11 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 +G LC+ICGDRA+GKHYG +C+GCKGFF+R++RK Y+ Sbjct: 6 NGVNCLCAICGDRATGKHYGASTCDGCKGFFRRSIRKSHIYS 47 >D49728-1|BAA08565.1| 598|Homo sapiens DNA binding protein protein. Length = 598 Score = 66.1 bits (154), Expect = 1e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 GS+ C++CGD AS +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 GSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKY 301 >CR456704-1|CAG32985.1| 598|Homo sapiens NR4A1 protein. Length = 598 Score = 66.1 bits (154), Expect = 1e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 GS+ C++CGD AS +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 GSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKY 301 >BT007144-1|AAP35808.1| 598|Homo sapiens nuclear receptor subfamily 4, group A, member 1 protein. Length = 598 Score = 66.1 bits (154), Expect = 1e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 GS+ C++CGD AS +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 GSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKY 301 >BC016147-1|AAH16147.1| 598|Homo sapiens nuclear receptor subfamily 4, group A, member 1 protein. Length = 598 Score = 66.1 bits (154), Expect = 1e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 GS+ C++CGD AS +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 GSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKY 301 >AK131566-1|BAD18699.1| 652|Homo sapiens protein ( Homo sapiens cDNA FLJ16818 fis, clone TRACH1000193, highly similar to Orphan nuclear receptor HMR. ). Length = 652 Score = 66.1 bits (154), Expect = 1e-10 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 520 GSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 GS+ C++CGD AS +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 316 GSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKY 355 >U60477-1|AAB09475.1| 414|Homo sapiens apoliprotein AI regulatory protein-1 protein. Length = 414 Score = 65.7 bits (153), Expect = 1e-10 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++L+Y Sbjct: 79 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSY 113 >M64497-1|AAA86429.1| 414|Homo sapiens apolipoprotein AI regulatory protein-1 protein. Length = 414 Score = 65.7 bits (153), Expect = 1e-10 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++L+Y Sbjct: 79 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSY 113 >M62760-1|AAA21479.1| 351|Homo sapiens ovalbumin upstream promoter transcription factor II protein. Length = 351 Score = 65.7 bits (153), Expect = 1e-10 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++L+Y Sbjct: 79 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSY 113 >L07592-1|AAA36469.1| 441|Homo sapiens peroxisome proliferator activated receptor protein. Length = 441 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >BC042897-1|AAH42897.1| 414|Homo sapiens nuclear receptor subfamily 2, group F, member 2 protein. Length = 414 Score = 65.7 bits (153), Expect = 1e-10 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++L+Y Sbjct: 79 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSY 113 >BC014664-1|AAH14664.1| 414|Homo sapiens nuclear receptor subfamily 2, group F, member 2 protein. Length = 414 Score = 65.7 bits (153), Expect = 1e-10 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD++SGKHYG ++CEGCK FFKR+VR++L+Y Sbjct: 79 CVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSY 113 >BC007578-1|AAH07578.1| 361|Homo sapiens PPARD protein protein. Length = 361 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >BC002715-1|AAH02715.1| 361|Homo sapiens PPARD protein protein. Length = 361 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >AY919140-1|AAX14041.1| 441|Homo sapiens peroxisome proliferator activated receptor delta protein. Length = 441 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >AY442342-1|AAR05439.1| 441|Homo sapiens peroxisome proliferative activated receptor, delta protein. Length = 441 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >AL022721-9|CAD92505.1| 361|Homo sapiens peroxisome proliferative activated receptor, delta protein. Length = 361 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >AL022721-8|CAB38629.1| 441|Homo sapiens peroxisome proliferative activated receptor, delta protein. Length = 441 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >AF246303-1|AAF62553.1| 441|Homo sapiens peroxisome proliferative activated receptor delta protein. Length = 441 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >AB099507-1|BAC78903.1| 161|Homo sapiens peroxisome proliferative activated receptor-delta isoform protein. Length = 161 Score = 65.7 bits (153), Expect = 1e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 74 CRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEY 108 >X90563-2|CAA62153.1| 475|Homo sapiens peroxisome proliferator activated receptor gamma protein. Length = 475 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 109 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 143 >X90563-1|CAA62152.1| 477|Homo sapiens peroxisome proliferator activated receptor gamma protein. Length = 477 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 111 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 145 >U79012-1|AAC51248.1| 505|Homo sapiens ligand activated transcription factor PPARgamma2 protein. Length = 505 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 139 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 173 >U63415-1|AAB04028.1| 505|Homo sapiens peroxisome proliferator activated receptor gamma 2 protein. Length = 505 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 139 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 173 >M24898-1|AAA52335.1| 614|Homo sapiens triiodothyronine receptor protein. Length = 614 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +1 Query: 514 LSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 L+G LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 125 LNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 166 >L40904-1|AAA80314.2| 477|Homo sapiens peroxisome proliferator activated receptor gamma protein. Length = 477 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 111 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 145 >D83233-1|BAA18949.1| 506|Homo sapiens PPAR gamma2 protein. Length = 506 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 139 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 173 >DQ356894-1|ABC97372.1| 186|Homo sapiens peroxisome proliferative acitvated receptor gamma protein. Length = 186 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 111 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 145 >BT007281-1|AAP35945.1| 477|Homo sapiens peroxisome proliferative activated receptor, gamma protein. Length = 477 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 111 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 145 >BC056148-1|AAH56148.1| 614|Homo sapiens nuclear receptor subfamily 1, group D, member 1 protein. Length = 614 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +1 Query: 514 LSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 L+G LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 125 LNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 166 >BC047875-1|AAH47875.1| 614|Homo sapiens nuclear receptor subfamily 1, group D, member 1 protein. Length = 614 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +1 Query: 514 LSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 L+G LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 125 LNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 166 >BC006811-1|AAH06811.1| 477|Homo sapiens peroxisome proliferator-activated receptor gamma protein. Length = 477 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 111 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 145 >AY222643-1|AAO66458.1| 584|Homo sapiens CREB3L2-PPARgamma protein. Length = 584 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 218 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 252 >AY157024-1|AAN38992.2| 475|Homo sapiens peroxisome proliferative activated receptor gamma protein. Length = 475 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 109 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 143 >AK223528-1|BAD97248.1| 478|Homo sapiens peroxisome proliferative activated receptor gamma isoform 2 variant protein. Length = 478 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 112 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 146 >AJ698135-1|CAG29019.1| 248|Homo sapiens peroxisome proliferative activated receptor gamma protein. Length = 248 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 109 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 143 >AJ563370-1|CAD91389.1| 264|Homo sapiens peroxisome proliferative activated receptor gamma protein. Length = 264 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 109 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 143 >AJ563369-1|CAD91388.1| 280|Homo sapiens peroxisome proliferative activated receptor gamma protein. Length = 280 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 125 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 159 >AB005526-1|BAA23354.1| 474|Homo sapiens peroxisome proliferator activated-receptor gamma protein. Length = 474 Score = 65.3 bits (152), Expect = 2e-10 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD+ASG HYGV++CEGCKGFF+RT+R L Y Sbjct: 111 CRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIY 145 >L31785-1|AAA65937.1| 579|Homo sapiens orphan nuclear hormone receptor BD73 protein. Length = 579 Score = 64.9 bits (151), Expect = 2e-10 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 96 SGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 136 >D16815-1|BAA20088.1| 579|Homo sapiens EAR-1r protein. Length = 579 Score = 64.9 bits (151), Expect = 2e-10 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 97 SGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 137 >CR457434-1|CAG33715.1| 579|Homo sapiens NR1D2 protein. Length = 579 Score = 64.9 bits (151), Expect = 2e-10 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 97 SGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 137 >BC070035-1|AAH70035.1| 408|Homo sapiens NR1D2 protein protein. Length = 408 Score = 64.9 bits (151), Expect = 2e-10 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 97 SGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 137 >BC045613-1|AAH45613.1| 579|Homo sapiens nuclear receptor subfamily 1, group D, member 2 protein. Length = 579 Score = 64.9 bits (151), Expect = 2e-10 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 97 SGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 137 >AJ276674-1|CAB82769.1| 410|Homo sapiens photoreceptor-specific nuclear receptor protein. Length = 410 Score = 64.9 bits (151), Expect = 2e-10 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD +SGKHYG+Y+C GC GFFKR+VR+ L Y Sbjct: 47 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIY 81 >AF148128-1|AAF22227.1| 367|Homo sapiens nuclear receptor protein. Length = 367 Score = 64.9 bits (151), Expect = 2e-10 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD +SGKHYG+Y+C GC GFFKR+VR+ L Y Sbjct: 47 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIY 81 >AF121129-1|AAD28301.1| 410|Homo sapiens photoreceptor-specific nuclear receptor protein. Length = 410 Score = 64.9 bits (151), Expect = 2e-10 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +CGD +SGKHYG+Y+C GC GFFKR+VR+ L Y Sbjct: 47 CRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIY 81 >AB209091-1|BAD92328.1| 549|Homo sapiens Orphan nuclear receptor NR1D2 variant protein. Length = 549 Score = 64.9 bits (151), Expect = 2e-10 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG LC +CGD ASG HYGV++CEGCKGFF+R++++++ Y Sbjct: 66 SGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQY 106 >Y07619-1|CAA68898.1| 468|Homo sapiens peroxisome proliferator-activated receptor alpha protein. Length = 468 Score = 64.5 bits (150), Expect = 3e-10 Identities = 26/42 (61%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 517 SGSKHL-CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 SG+ ++ C ICGD+ASG HYGV++CEGC GFF+RT+R L Y Sbjct: 95 SGALNIECRICGDKASGYHYGVHACEGCMGFFRRTIRLKLVY 136 >X72631-1|CAB53540.1| 614|Homo sapiens Rev-ErbAalpha protein protein. Length = 614 Score = 64.1 bits (149), Expect = 4e-10 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = +1 Query: 514 LSGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 L+G LC +CGD ASG HYGV +CEGCKGFF+R++++++ Y Sbjct: 125 LNGMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQY 166 >X75918-1|CAA53518.1| 598|Homo sapiens NOT protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 297 >S77154-1|AAB33999.1| 535|Homo sapiens TINUR protein. Length = 535 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 199 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 234 >L13740-1|AAA36763.1| 598|Homo sapiens TR3 orphan receptor protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 523 SKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S+ C++CGD AS +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 263 SEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKY 301 >BC066890-1|AAH66890.1| 535|Homo sapiens nuclear receptor subfamily 4, group A, member 2 protein. Length = 535 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 199 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 234 >BC009288-1|AAH09288.1| 598|Homo sapiens nuclear receptor subfamily 4, group A, member 2 protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 297 >AK223625-1|BAD97345.1| 598|Homo sapiens nuclear receptor subfamily 4, group A, member 2 isoform a variant protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 297 >AC074099-1|AAY24203.1| 598|Homo sapiens unknown protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 297 >AB019433-1|BAA77328.1| 598|Homo sapiens T-cell nuclear receptor NOT (Nurr1) protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 297 >AB017586-1|BAA75666.1| 598|Homo sapiens Nurr1 protein. Length = 598 Score = 63.7 bits (148), Expect = 5e-10 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 262 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 297 >X89894-1|CAA61984.1| 443|Homo sapiens nuclear receptor protein. Length = 443 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 286 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 326 >U12767-1|AAB02581.1| 587|Homo sapiens mitogen induced nuclear orphan receptor protein. Length = 587 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 247 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 287 >S81243-1|AAB36006.1| 684|Homo sapiens CHN protein. Length = 684 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 344 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 384 >D78579-1|BAA11419.1| 626|Homo sapiens neuron derived orphan receptor protein. Length = 626 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 286 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 326 >AL359710-3|CAI95139.1| 443|Homo sapiens nuclear receptor subfamily 4, group A, member 3 protein. Length = 443 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 286 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 326 >AL359710-2|CAI95138.1| 626|Homo sapiens nuclear receptor subfamily 4, group A, member 3 protein. Length = 626 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 286 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 326 >AL359710-1|CAM16648.1| 637|Homo sapiens nuclear receptor subfamily 4, group A, member 3 protein. Length = 637 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 297 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 337 >AL358937-4|CAI95320.1| 626|Homo sapiens nuclear receptor subfamily 4, group A, member 3 protein. Length = 626 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 286 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 326 >AL358937-3|CAM22558.1| 637|Homo sapiens nuclear receptor subfamily 4, group A, member 3 protein. Length = 637 Score = 62.9 bits (146), Expect = 9e-10 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 517 SGSKHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 S + C++CGD A+ +HYGV +CEGCKGFFKRTV+K+ Y Sbjct: 297 SSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKY 337 >U64876-1|AAB06335.1| 480|Homo sapiens nuclear orphan receptor protein. Length = 480 Score = 62.5 bits (145), Expect = 1e-09 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ K Y Sbjct: 60 CLICGDRATGLHYGIISCEGCKGFFKRSICKKRVY 94 >U22662-1|AAA85856.1| 447|Homo sapiens nuclear orphan receptor LXR-alpha protein. Length = 447 Score = 62.5 bits (145), Expect = 1e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LCS+CGD+ASG HY V SCEGCKGFF+R+V K Y Sbjct: 97 LCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHY 132 >BT019411-1|AAV38218.1| 447|Homo sapiens nuclear receptor subfamily 1, group H, member 3 protein. Length = 447 Score = 62.5 bits (145), Expect = 1e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LCS+CGD+ASG HY V SCEGCKGFF+R+V K Y Sbjct: 97 LCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHY 132 >BC041172-1|AAH41172.1| 402|Homo sapiens NR1H3 protein protein. Length = 402 Score = 62.5 bits (145), Expect = 1e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LCS+CGD+ASG HY V SCEGCKGFF+R+V K Y Sbjct: 52 LCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHY 87 >BC008819-1|AAH08819.1| 387|Homo sapiens NR1H3 protein protein. Length = 387 Score = 62.5 bits (145), Expect = 1e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LCS+CGD+ASG HY V SCEGCKGFF+R+V K Y Sbjct: 97 LCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHY 132 >X51417-1|CAA35779.1| 433|Homo sapiens protein ( Human mRNA for steroid hormone receptor hERR2. ). Length = 433 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 100 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 138 >BC131517-1|AAI31518.1| 503|Homo sapiens ESRRB protein protein. Length = 503 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 100 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 138 >BC064700-1|AAH64700.1| 442|Homo sapiens ESRRG protein protein. Length = 442 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >BC008218-1|AAH08218.1| 343|Homo sapiens ESRRG protein protein. Length = 343 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY528719-1|AAS00098.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY451390-1|AAS15572.1| 508|Homo sapiens estrogen receptor-related receptor beta2-delta-10 protein. Length = 508 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 100 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 138 >AY451389-1|AAS15571.1| 433|Homo sapiens estrogen receptor-related receptor beta short form protein. Length = 433 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 100 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 138 >AY388461-1|AAQ93381.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY388460-1|AAQ93380.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY388459-1|AAQ93379.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY388458-1|AAQ93378.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY388457-1|AAQ93377.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AY388456-1|AAQ93376.1| 458|Homo sapiens estrogen-related receptor gamma protein. Length = 458 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 125 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 163 >AL512650-2|CAH71595.1| 442|Homo sapiens estrogen-related receptor gamma protein. Length = 442 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AL512650-1|CAH71594.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AL445650-2|CAH70619.1| 442|Homo sapiens estrogen-related receptor gamma protein. Length = 442 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AL445650-1|CAH70618.1| 435|Homo sapiens estrogen-related receptor gamma protein. Length = 435 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 102 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 140 >AF094518-1|AAC99410.1| 458|Homo sapiens nuclear receptor ERRG2 protein. Length = 458 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 125 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 163 >AF094517-1|AAC99409.1| 500|Homo sapiens nuclear receptor ERRB2 protein. Length = 500 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 100 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 138 >AC016543-1|AAG29619.1| 262|Homo sapiens hERRB2 protein. Length = 262 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 100 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 138 >AB020639-1|BAA74855.2| 469|Homo sapiens KIAA0832 protein protein. Length = 469 Score = 61.7 bits (143), Expect = 2e-09 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ ++ Y+ Sbjct: 136 KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS 174 >X51416-1|CAA35778.1| 521|Homo sapiens protein ( Human mRNA for steroid hormone receptor hERR1. ). Length = 521 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 173 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 211 >M57707-1|AAA63254.1| 454|Homo sapiens retinoic acid receptor-gamma protein. Length = 454 Score = 61.3 bits (142), Expect = 3e-09 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV SCEGCKGFF+R+++K++ Y Sbjct: 90 CFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVY 124 >M38258-1|AAA60254.1| 454|Homo sapiens retinoic acid receptor-gamma-1 protein. Length = 454 Score = 61.3 bits (142), Expect = 3e-09 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV SCEGCKGFF+R+++K++ Y Sbjct: 90 CFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVY 124 >M24857-1|AAA52692.1| 454|Homo sapiens RARG protein. Length = 454 Score = 61.3 bits (142), Expect = 3e-09 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV SCEGCKGFF+R+++K++ Y Sbjct: 90 CFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVY 124 >L38487-1|AAB17015.1| 481|Homo sapiens estrogen receptor-related protein protein. Length = 481 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 135 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 173 >DQ514553-1|ABF47104.1| 423|Homo sapiens estrogen-related receptor alpha protein. Length = 423 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 76 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 114 >BC093729-1|AAH93729.1| 454|Homo sapiens retinoic acid receptor, gamma protein. Length = 454 Score = 61.3 bits (142), Expect = 3e-09 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV SCEGCKGFF+R+++K++ Y Sbjct: 90 CFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVY 124 >BC093727-1|AAH93727.1| 454|Homo sapiens retinoic acid receptor, gamma protein. Length = 454 Score = 61.3 bits (142), Expect = 3e-09 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV SCEGCKGFF+R+++K++ Y Sbjct: 90 CFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVY 124 >BC093722-1|AAH93722.1| 423|Homo sapiens estrogen-related receptor alpha protein. Length = 423 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 76 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 114 >BC093720-1|AAH93720.1| 423|Homo sapiens estrogen-related receptor alpha protein. Length = 423 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 76 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 114 >BC092470-1|AAH92470.1| 423|Homo sapiens ESRRA protein protein. Length = 423 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 76 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 114 >BC063795-1|AAH63795.2| 423|Homo sapiens estrogen-related receptor alpha protein. Length = 423 Score = 61.3 bits (142), Expect = 3e-09 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 K LC +CGD ASG HYGV SCE CK FFKRT++ + Y+ Sbjct: 76 KRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYS 114 >U68233-1|AAB08107.1| 472|Homo sapiens farnesol receptor HRR-1 protein. Length = 472 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGDRASG HY +CEGCKGFF+R++ K+ Y Sbjct: 126 LCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVY 161 >U04899-1|AAA62660.1| 548|Homo sapiens RORalpha3 protein. Length = 548 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 98 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 133 >U04898-1|AAA62659.1| 556|Homo sapiens RORalpha2 protein. Length = 556 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 106 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 141 >U04897-1|AAA62658.1| 523|Homo sapiens RORalpha1 protein. Length = 523 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 73 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 108 >L14611-1|AAA02963.1| 468|Homo sapiens transcription factor protein. Length = 468 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 53 >BC130573-1|AAI30574.1| 476|Homo sapiens NR1H4 protein protein. Length = 476 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGDRASG HY +CEGCKGFF+R++ K+ Y Sbjct: 126 LCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVY 161 >BC100990-1|AAI00991.1| 468|Homo sapiens RAR-related orphan receptor A protein. Length = 468 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 53 >BC100989-1|AAI00990.1| 468|Homo sapiens RAR-related orphan receptor A protein. Length = 468 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 53 >BC100988-1|AAI00989.1| 468|Homo sapiens RAR-related orphan receptor A protein. Length = 468 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 53 >BC100987-1|AAI00988.1| 468|Homo sapiens RAR-related orphan receptor A protein. Length = 468 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 18 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 53 >BC071778-1|AAH71778.1| 475|Homo sapiens NR1H4 protein protein. Length = 475 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGDRASG HY +CEGCKGFF+R++ K+ Y Sbjct: 125 LCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVY 160 >BC008831-1|AAH08831.1| 523|Homo sapiens RAR-related orphan receptor A protein. Length = 523 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + TY+ Sbjct: 73 CKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYS 108 >AF478446-1|AAM53551.1| 486|Homo sapiens farnesoid-X-receptor beta splice variant 2 protein. Length = 486 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGDRASG HY +CEGCKGFF+R++ K+ Y Sbjct: 136 LCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVY 171 >AF478445-1|AAM53550.1| 482|Homo sapiens farnesoid-X-receptor beta splice variant 1 protein. Length = 482 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGDRASG HY +CEGCKGFF+R++ K+ Y Sbjct: 136 LCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVY 171 >AF384555-1|AAK60271.1| 476|Homo sapiens farnesol receptor protein. Length = 476 Score = 60.9 bits (141), Expect = 4e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGDRASG HY +CEGCKGFF+R++ K+ Y Sbjct: 126 LCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVY 161 >X99975-1|CAA68236.1| 480|Homo sapiens hRTR/hGCNF protein protein. Length = 480 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 60 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 94 >U93553-1|AAD03155.1| 500|Homo sapiens alpha1-fetoprotein transcription factor protein. Length = 500 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 43 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 80 >U80802-1|AAB96828.1| 480|Homo sapiens orphan nuclear receptor GCNF protein. Length = 480 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 60 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 94 >U80251-1|AAC78727.1| 495|Homo sapiens hepatocytic transcription factor protein. Length = 495 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 37 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 74 >S83309-1|AAB50876.1| 476|Homo sapiens germ cell nuclear factor protein. Length = 476 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 56 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 90 >BC118652-1|AAI18653.1| 495|Homo sapiens nuclear receptor subfamily 5, group A, member 2 protein. Length = 495 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 37 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 74 >BC118571-1|AAI18572.1| 495|Homo sapiens nuclear receptor subfamily 5, group A, member 2 protein. Length = 495 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 37 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 74 >BC030600-1|AAH30600.1| 475|Homo sapiens nuclear receptor subfamily 6, group A, member 1 protein. Length = 475 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 56 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 90 >AL354979-4|CAI10960.1| 479|Homo sapiens nuclear receptor subfamily 6, group A, member 1 protein. Length = 479 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 60 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 94 >AL354928-2|CAI39633.1| 479|Homo sapiens nuclear receptor subfamily 6, group A, member 1 protein. Length = 479 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 60 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 94 >AL158075-1|CAI13577.1| 479|Homo sapiens nuclear receptor subfamily 6, group A, member 1 protein. Length = 479 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 60 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 94 >AF190464-2|AAG17124.1| 495|Homo sapiens hepatocytic transcription factor B1F protein. Length = 495 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 37 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 74 >AF190464-1|AAG17125.1| 541|Homo sapiens hepatocytic transcription factor isoform B1F-2 protein. Length = 541 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 83 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 120 >AF146343-1|AAD37378.1| 495|Homo sapiens CYP7A promoter binding factor protein. Length = 495 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 37 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 74 >AF124247-1|AAD26565.1| 541|Homo sapiens hepatocytic transcription factor hB1F-2 protein. Length = 541 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 83 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 120 >AF049102-1|AAD03248.1| 323|Homo sapiens alpha1-fetoprotein transcription factor short variant protein. Length = 323 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 3 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 40 >AF004291-1|AAC52054.1| 454|Homo sapiens germ cell nuclear factor protein. Length = 454 Score = 60.5 bits (140), Expect = 5e-09 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C ICGDRA+G HYG+ SCEGCKGFFKR++ Y Sbjct: 34 CLICGDRATGLHYGIISCEGCKGFFKRSICNKRVY 68 >AB019246-1|BAA34092.1| 541|Homo sapiens FTZ-F1 related protein protein. Length = 541 Score = 60.5 bits (140), Expect = 5e-09 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +1 Query: 526 KHLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 + LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 83 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY 120 >AJ250835-1|CAB60726.1| 381|Homo sapiens retinoic acid receptor protein. Length = 381 Score = 60.1 bits (139), Expect = 7e-09 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV SCEGCKGFF+R+ +K++ Y Sbjct: 17 CFVCNDKSSGYHYGVSSCEGCKGFFRRSTQKNMVY 51 >X99101-1|CAA67555.1| 477|Homo sapiens estrogen receptor beta protein. Length = 477 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 94 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 125 >U76388-1|AAB53105.1| 461|Homo sapiens steroidogenic factor 1 protein. Length = 461 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >D88155-1|BAA13546.1| 461|Homo sapiens AdBP4 protein. Length = 461 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >DQ838583-1|ABH09190.1| 472|Homo sapiens estrogen receptor beta isoform 5 protein. Length = 472 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >DQ838582-1|ABH09189.1| 481|Homo sapiens estrogen receptor beta isoform 4 protein. Length = 481 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >DQ777076-1|ABG88022.1| 474|Homo sapiens estrogen receptor beta 4 protein. Length = 474 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >BC032501-1|AAH32501.1| 461|Homo sapiens nuclear receptor subfamily 5, group A, member 1 protein. Length = 461 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >BC024181-1|AAH24181.1| 323|Homo sapiens ESR2 protein protein. Length = 323 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AY785359-1|AAV31779.1| 530|Homo sapiens estrogen receptor 2 (ER beta) protein. Length = 530 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AY542548-1|AAS48621.1| 81|Homo sapiens nuclear receptor AdBP4 protein. Length = 81 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >AL354979-3|CAI10959.1| 461|Homo sapiens nuclear receptor subfamily 5, group A, member 1 protein. Length = 461 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >AL354979-2|CAI10958.1| 178|Homo sapiens nuclear receptor subfamily 5, group A, member 1 protein. Length = 178 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >AL137846-2|CAI10872.1| 461|Homo sapiens nuclear receptor subfamily 5, group A, member 1 protein. Length = 461 Score = 59.7 bits (138), Expect = 9e-09 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = +1 Query: 532 LCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 LC +CGD+ SG HYG+ +CE CKGFFKRTV+ + Y Sbjct: 12 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHY 47 >AF215937-2|AAG29940.1| 530|Homo sapiens 5p152 protein. Length = 530 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AF124790-1|AAD32580.1| 323|Homo sapiens estrogen receptor beta2 splice variant protein. Length = 323 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AF074599-1|AAC25603.1| 381|Homo sapiens estrogen receptor beta isoform 5/6 protein. Length = 381 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 89 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 120 >AF060555-1|AAC15234.1| 513|Homo sapiens estrogen receptor beta 3 isoform protein. Length = 513 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AF051428-1|AAC05751.1| 495|Homo sapiens estrogen receptor beta2 splice variant protein. Length = 495 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AF051427-1|AAC05985.1| 530|Homo sapiens estrogen receptor beta protein. Length = 530 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AB209620-1|BAD92857.1| 504|Homo sapiens estrogen receptor 2 (ER beta) variant protein. Length = 504 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 179 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 210 >AB006590-1|BAA24953.1| 530|Homo sapiens estrogen receptor beta protein. Length = 530 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >AB006589-1|BAA31966.1| 495|Homo sapiens estrogen receptor beta cx protein. Length = 495 Score = 59.7 bits (138), Expect = 9e-09 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 529 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVR 624 H C++C D ASG HYGV+SCEGCK FFKR+++ Sbjct: 147 HFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQ 178 >Y08639-1|CAA69929.1| 459|Homo sapiens nuclear orphan receptor ROR-beta protein. Length = 459 Score = 59.3 bits (137), Expect = 1e-08 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ + + +Y+ Sbjct: 10 CKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYS 45 >X06614-1|CAA29829.1| 462|Homo sapiens protein ( Human mRNA for receptor of retinoic acid. ). Length = 462 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 88 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 122 >X06538-1|CAA29787.1| 432|Homo sapiens protein ( Human mRNA for retinoic acid receptor. ). Length = 432 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 58 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 92 >U41743-1|AAB00113.1| 520|Homo sapiens nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR short form protein. Length = 520 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 146 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 180 >U41742-1|AAB00112.1| 563|Homo sapiens nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form protein. Length = 563 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 189 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 223 >U16997-1|AAA64751.1| 560|Homo sapiens ROR gamma protein. Length = 560 Score = 59.3 bits (137), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ R + Y+ Sbjct: 31 CKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYS 66 >S50916-1|AAB19602.2| 416|Homo sapiens retinoic acid receptor alpha protein. Length = 416 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 42 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 76 >M73779-1|AAA60126.1| 797|Homo sapiens PML-RAR protein protein. Length = 797 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 423 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 457 >CR457438-1|CAG33719.1| 462|Homo sapiens RARA protein. Length = 462 Score = 59.3 bits (137), Expect = 1e-08 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTY 639 C +C D++SG HYGV +CEGCKGFF+R+++K++ Y Sbjct: 88 CFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVY 122 >CR457436-1|CAG33717.1| 518|Homo sapiens RORC protein. Length = 518 Score = 59.3 bits (137), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ R + Y+ Sbjct: 31 CKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYS 66 >BC110571-1|AAI10572.1| 518|Homo sapiens RAR-related orphan receptor C protein. Length = 518 Score = 59.3 bits (137), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +1 Query: 535 CSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYA 642 C ICGD++SG HYGV +CEGCKGFF+R+ R + Y+ Sbjct: 31 CKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYS 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,340,569 Number of Sequences: 237096 Number of extensions: 1380609 Number of successful extensions: 3539 Number of sequences better than 10.0: 392 Number of HSP's better than 10.0 without gapping: 3421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3537 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7085195460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -