BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0439 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2C4.07c |||ribonuclease II |Schizosaccharomyces pombe|chr 1|... 27 2.8 SPAC16E8.18 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 3.7 >SPAC2C4.07c |||ribonuclease II |Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 60 GNCGRRTTYK*HYTLKFKHGSHFT 131 G+ G +T + HY L F H +HFT Sbjct: 744 GDFGEKTDWH-HYALSFNHYTHFT 766 >SPAC16E8.18 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 107 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 311 FREILSSGTEYLIILP-CKGRLNIFKHQGY 225 F+E G YLIILP N+F+H Y Sbjct: 12 FKEFACFGNNYLIILPGIMLERNVFRHLNY 41 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,701,736 Number of Sequences: 5004 Number of extensions: 52586 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -