BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0438 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces p... 27 2.1 SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy... 26 4.8 >SPBC1271.11 |||tricarboxylate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 258 Score = 27.5 bits (58), Expect = 2.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 487 PLATVTKQYQTSLSFTQKHFLQHIF 413 PL+T+ + Q+SLSF Q QH++ Sbjct: 27 PLSTIITRVQSSLSFQQAGGFQHLY 51 >SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 444 NDKDV*YCLVTVARGPRGLGPAVARGHRQRCKLNICSECR 563 ND ++ +C + +GP P Q+C CS C+ Sbjct: 259 NDSNIIFCPRSFCQGPSKRDPGQKLAICQKCDFAFCSFCQ 298 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,637,221 Number of Sequences: 5004 Number of extensions: 50279 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -