BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0437 (736 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identic... 70 1e-12 At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) iden... 46 3e-05 At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / AC... 44 1e-04 At3g05420.2 68416.m00594 acyl-CoA binding family protein similar... 36 0.037 At3g05420.1 68416.m00593 acyl-CoA binding family protein similar... 36 0.037 At1g31730.1 68414.m03893 epsilon-adaptin, putative similar to SP... 29 3.2 At3g13620.1 68416.m01714 amino acid permease family protein weak... 29 4.2 At3g18900.1 68416.m02400 expressed protein contains Pfam profile... 28 7.4 >At1g31812.1 68414.m03905 acyl-CoA binding protein / ACBP identical to acyl-CoA-binding protein (ACBP) [Arabidopsis thaliana] SWISS-PROT:P57752 Length = 92 Score = 70.1 bits (164), Expect = 1e-12 Identities = 35/84 (41%), Positives = 51/84 (60%) Frame = +3 Query: 51 MSLQEKFDQAAANVKNLKALPTDAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDA 230 M L+E+F++ A V L LP++ LL LY +KQA G D +RPG+ +K +AK+DA Sbjct: 1 MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVD-TSRPGMFSMKERAKWDA 59 Query: 231 WHKLAGTSKEDAQKAYIEIVEGLI 302 W + G S E+A YI V+ L+ Sbjct: 60 WKAVEGKSSEEAMNDYITKVKQLL 83 >At4g27780.1 68417.m03990 acyl-CoA binding protein 2 (ACBP2) identical to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 354 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/77 (37%), Positives = 40/77 (51%) Frame = +3 Query: 69 FDQAAANVKNLKALPTDAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDAWHKLAG 248 F AA + + +P+D Q LY +K AT G A +P L + +AK+ AW KL Sbjct: 114 FVTTAAADRLSQKVPSDVQQ-QLYGLYKIATEGPCT-APQPSALKMTARAKWQAWQKLGA 171 Query: 249 TSKEDAQKAYIEIVEGL 299 E+A + YIEIV L Sbjct: 172 MPPEEAMEKYIEIVTQL 188 >At5g53470.1 68418.m06645 acyl-CoA binding protein, putative / ACBP, putative similar to acyl-CoA binding protein 2 [Arabidopsis thaliana] gi|12039034|gb|AAG46057 Length = 338 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/77 (35%), Positives = 41/77 (53%) Frame = +3 Query: 69 FDQAAANVKNLKALPTDAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDAWHKLAG 248 F AAA+ + + + + QL LY +K AT G A +P L + +AK+ AW KL Sbjct: 104 FVAAAASDRLSQKVSNELQL-QLYGLYKIATEGPCT-APQPSALKMTARAKWQAWQKLGA 161 Query: 249 TSKEDAQKAYIEIVEGL 299 E+A + YI++V L Sbjct: 162 MPPEEAMEKYIDLVTQL 178 >At3g05420.2 68416.m00594 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 669 Score = 35.5 bits (78), Expect = 0.037 Identities = 23/74 (31%), Positives = 39/74 (52%) Frame = +3 Query: 72 DQAAANVKNLKALPTDAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDAWHKLAGT 251 D +A NV + P D LL LYA ++QATVG + +P ++K+ +W L Sbjct: 29 DSSAKNV--ISKFPDDTALL-LYALYQQATVGPCN-TPKPSAWRPVEQSKWKSWQGLGTM 84 Query: 252 SKEDAQKAYIEIVE 293 +A + +++I+E Sbjct: 85 PSIEAMRLFVKILE 98 >At3g05420.1 68416.m00593 acyl-CoA binding family protein similar to PIR|S68824|S68824 rngB protein, cytosolic (Dictyostelium discoideum); contains Pfam profiles PF00887: Acyl CoA binding protein, PF01344: Kelch motif Length = 668 Score = 35.5 bits (78), Expect = 0.037 Identities = 23/74 (31%), Positives = 39/74 (52%) Frame = +3 Query: 72 DQAAANVKNLKALPTDAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDAWHKLAGT 251 D +A NV + P D LL LYA ++QATVG + +P ++K+ +W L Sbjct: 29 DSSAKNV--ISKFPDDTALL-LYALYQQATVGPCN-TPKPSAWRPVEQSKWKSWQGLGTM 84 Query: 252 SKEDAQKAYIEIVE 293 +A + +++I+E Sbjct: 85 PSIEAMRLFVKILE 98 >At1g31730.1 68414.m03893 epsilon-adaptin, putative similar to SP|Q9UPM8 Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit) {Homo sapiens}; contains Pfam profile: PF01602 Adaptin N terminal region Length = 938 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 656 LNQNKYKTERPSTCILLKHDFEKDASYFIAV 564 +N N YKTE S C+ L F +FI + Sbjct: 409 INDNHYKTEIASRCVELAEQFAPSNQWFIQI 439 >At3g13620.1 68416.m01714 amino acid permease family protein weak similarity to SP|Q9WTR6 Cystine/glutamate transporter (Amino acid transport system xc-) {Mus musculus}; contains Pfam profile PF00324: Amino acid permease Length = 478 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 142 AYKLRSWASVGRAFRFFTLAAAWSNFSWRDILI 44 AY+L A +G +FF + + W N W ILI Sbjct: 314 AYQLEGMAELGFLPKFFGVRSKWFNTPWVGILI 346 >At3g18900.1 68416.m02400 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 815 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 635 TERPSTCILLKHDFEKDASYFIAVQYYALAPWKYRS 528 TE P T LLK DF + S + + Y++L ++ + Sbjct: 649 TETPRTISLLKFDFSIEKSVLVPLPYHSLQSRRFEA 684 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,822,404 Number of Sequences: 28952 Number of extensions: 287518 Number of successful extensions: 697 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -