BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0436 (757 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 26 0.28 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 23 3.5 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 6.1 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 26.2 bits (55), Expect = 0.28 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +1 Query: 499 VLKNLTDGAVLNSMYISVSFIL-HIFVFVSLTCRFFRCIRFEITTILKK 642 VL LT L+ + S + HIF F ++ C F I I + +K Sbjct: 50 VLTILTSSVTLHVCFNSYMYAFTHIFFFFAICCDFIALIVVNIVHVFRK 98 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 361 ILNVLSICKILSLVNNCKVAPS 426 I++ ++ ILS+VN C PS Sbjct: 319 IMSAAAVEHILSIVNTCSQIPS 340 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 9 AAGAIVYRSYPLRL 50 AA A YRS+PL L Sbjct: 30 AAAAAAYRSFPLSL 43 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,734 Number of Sequences: 336 Number of extensions: 3887 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -