BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0435 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 27 0.17 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 6.2 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.2 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 27.1 bits (57), Expect = 0.17 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 63 DEMRRRRNEVT-VELRKNKREETLQKRRNVPISYSTDEEEIDK 188 ++ ++ RNE ++LR +EE LQ RR + E+E +K Sbjct: 13 EKFKQLRNEDNKIDLRSRTKEERLQYRREAWLVQQEREQEYEK 55 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = +3 Query: 321 LIAAGILPILVQCLSRADNPALQFETAWALTNIA 422 + G + ++ C+ NP++Q T + L N+A Sbjct: 43 IFVTGFVGNIITCIVIWRNPSMQTPTNYYLFNLA 76 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 22 KNACMCSRMQAKMSMK 69 +NAC C+R + M +K Sbjct: 482 QNACFCARNELMMILK 497 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 21 EKRMHVFKNAGKDVDEMRRRRNEVTVELRKNKRE 122 +K + + + GKD M R ++ E RKNK + Sbjct: 440 KKMLKIKRLFGKDRKIMDMVREKIIEEKRKNKNK 473 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,400 Number of Sequences: 438 Number of extensions: 3887 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -