BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0428 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY752895-1|AAV30069.1| 95|Anopheles gambiae peroxidase 3 protein. 25 3.0 DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. 24 5.3 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 23 9.2 >AY752895-1|AAV30069.1| 95|Anopheles gambiae peroxidase 3 protein. Length = 95 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 595 FQEKNHILCVQYQIANHYYILLKIVTRAPCFNGRCL*E 482 FQE I QYQ +Y L +I+ RA + R + E Sbjct: 44 FQEARRINIAQYQQIVYYEYLPRILGRANMLSSRLIFE 81 >DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. Length = 144 Score = 23.8 bits (49), Expect = 5.3 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 278 ANRSRNRKGNKDFTKKKIHNYF 213 A ++NR G+KD+ +I+NY+ Sbjct: 57 ALNTKNRDGSKDYGIFQINNYY 78 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 349 DSRHEFFSLLNLKYQIRSKLVNEKKNYLIKAKAF 450 D+RHE +L L+ + N KNY K F Sbjct: 99 DTRHELLGVLRLEQYRKPGSGNIPKNYARLLKEF 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,705 Number of Sequences: 2352 Number of extensions: 12280 Number of successful extensions: 26 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -