BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0427 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 3.0 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 3.0 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 23 3.0 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 4.0 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 9.1 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 457 SCCVCPCDLSYV 422 SC VC CD Y+ Sbjct: 773 SCTVCTCDAKYL 784 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 139 INKICPLSRIIEQCVILLHKTFTDCIVL 56 +NKIC L + + V L ++TF ++L Sbjct: 502 LNKICALHHHLSKLVKLFNETFGIVLLL 529 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 139 INKICPLSRIIEQCVILLHKTFTDCIVL 56 +NKIC L + + V L ++TF ++L Sbjct: 227 LNKICALHHHLSKLVKLFNETFGIVLLL 254 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 4.0 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = -1 Query: 571 NFINSLTK*IQEKYNVYQMSRILIQQLYVISNFKLSISSCCVCPC 437 +F++++ + EK NV + ++ L V NF +S +C C Sbjct: 232 DFLDNVDTIMYEKTNVTFVHLAVLNILRVGKNFVCLLSLIILCDC 276 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 527 IIFFLYLFRQRIYEIERTRRL*NY 598 I+FF+YL+ Q+ + ++ L Y Sbjct: 18 ILFFIYLYWQQTSNLTTSKLLYTY 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,562 Number of Sequences: 336 Number of extensions: 3502 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -