BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0420 (644 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q05FT4 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q7VRJ4 Cluster: DNA polymerase I; n=3; Enterobacteriace... 33 5.9 >UniRef50_Q05FT4 Cluster: Putative uncharacterized protein; n=1; Candidatus Carsonella ruddii PV|Rep: Putative uncharacterized protein - Carsonella ruddii (strain PV) Length = 189 Score = 35.5 bits (78), Expect = 1.1 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -1 Query: 533 LNNILNVQLKLSSLNLLIRKFFKIKHFYVKI 441 +N I+N+ L + +N I+K FKIK+FY K+ Sbjct: 73 INYIVNINLPFNIINFFIKKQFKIKNFYFKL 103 >UniRef50_Q7VRJ4 Cluster: DNA polymerase I; n=3; Enterobacteriaceae|Rep: DNA polymerase I - Blochmannia floridanus Length = 943 Score = 33.1 bits (72), Expect = 5.9 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -3 Query: 537 NAKQYFKRSTKTKFPKSPNTKIFQN*TFLR*NTAINNTSN--IFNT 406 N +Y K+ T + K NTKI QN ++ N +NN SN I+NT Sbjct: 300 NTNKYEKKIISTAYTKHANTKIIQNSSYN--NLKLNNNSNYIIYNT 343 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,156,885 Number of Sequences: 1657284 Number of extensions: 8257696 Number of successful extensions: 14063 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14062 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48541014171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -