BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0418 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55211| Best HMM Match : ADK_lid (HMM E-Value=9.5) 29 3.7 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 29 4.9 SB_9147| Best HMM Match : Sushi (HMM E-Value=0) 29 4.9 SB_8983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_55211| Best HMM Match : ADK_lid (HMM E-Value=9.5) Length = 123 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -2 Query: 371 ILDSQLVVGREYCDPVASCLA-SIAC 297 ++DS + R YCD VA+C S+AC Sbjct: 3 VIDSNWSIKRPYCDAVANCATKSLAC 28 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 524 INNSNCIIKNTLQIKTYVINCTKIRSMRN 438 I NSN I+KN +Q+ ++C + S RN Sbjct: 703 IINSNKILKNNIQVPLVAVDCGPLPSPRN 731 >SB_9147| Best HMM Match : Sushi (HMM E-Value=0) Length = 1656 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 524 INNSNCIIKNTLQIKTYVINCTKIRSMRN 438 I NSN I+KN +Q+ ++C + S RN Sbjct: 134 IINSNKILKNNIQVPLVAVDCGPLPSPRN 162 >SB_8983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 606 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 509 CIIKNTLQIKTYVINCTKIRSMRNKNNIRHR 417 C+I+ TL+IKT+ T +R + N+ + R R Sbjct: 33 CLIETTLEIKTF--ETTAVRPLTNETSARQR 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,213,664 Number of Sequences: 59808 Number of extensions: 402150 Number of successful extensions: 616 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -