BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0418 (711 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC024591-1|AAH24591.1| 1222|Homo sapiens histidine acid phosphat... 31 5.4 AB007893-1|BAA24863.2| 1255|Homo sapiens KIAA0433 protein. 31 5.4 >BC024591-1|AAH24591.1| 1222|Homo sapiens histidine acid phosphatase domain containing 1 protein. Length = 1222 Score = 30.7 bits (66), Expect = 5.4 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -2 Query: 578 EILKTNLHYTFTDFFFLSINNSNCIIKNTLQIKTYVINCTKIRSMRNK--NNIRHRYE 411 EIL+ + +T D+ L+ + S +IK+ IK V C K+ S+ + IRHR E Sbjct: 625 EILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPVKTCDKVYSLIQSLTSQIRHRME 682 >AB007893-1|BAA24863.2| 1255|Homo sapiens KIAA0433 protein. Length = 1255 Score = 30.7 bits (66), Expect = 5.4 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -2 Query: 578 EILKTNLHYTFTDFFFLSINNSNCIIKNTLQIKTYVINCTKIRSMRNK--NNIRHRYE 411 EIL+ + +T D+ L+ + S +IK+ IK V C K+ S+ + IRHR E Sbjct: 637 EILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPVKTCDKVYSLIQSLTSQIRHRME 694 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,252,300 Number of Sequences: 237096 Number of extensions: 1957690 Number of successful extensions: 2682 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2682 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8287202872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -