BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0415 (568 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0340 - 16536571-16536705,16536820-16536951,16537265-165381... 29 2.0 11_01_0305 + 2299681-2299860,2299940-2300260,2300346-2300600 28 4.5 09_04_0627 - 19061106-19061474,19062067-19062909,19063395-190635... 28 4.5 02_04_0206 + 20916063-20919669,20919816-20920014,20920935-209210... 27 7.9 01_04_0008 + 15041682-15041909,15042035-15042319,15042406-150427... 27 7.9 >11_04_0340 - 16536571-16536705,16536820-16536951,16537265-16538106, 16538480-16538940,16539032-16540314,16540423-16541627, 16541857-16542157 Length = 1452 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/69 (20%), Positives = 34/69 (49%) Frame = +3 Query: 225 HLQRKCATHFEI*VLKYSYNGCSTLQTETHYCFTAEIGEVVVPARA*RCFSMNTMVSSIV 404 HLQR C ++ + + ++ + +Q + HY + ++ A C+++ + SS + Sbjct: 478 HLQR-CFSYCSLFPEDHPFSAATLVQVDRHYVMHDLMHDLAQQVSAKECYTVRGLQSSTI 536 Query: 405 RYGCTYIIV 431 R G ++ + Sbjct: 537 RQGIRHLSI 545 >11_01_0305 + 2299681-2299860,2299940-2300260,2300346-2300600 Length = 251 Score = 28.3 bits (60), Expect = 4.5 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = -1 Query: 394 DTIVFIEKHRYARAGTTTSPISAVKQ*CVSVCRVEQPL*LYLRTYISKWVAHLRCRC 224 D +++ R+ A +T K CR +Q L T + W AH RCRC Sbjct: 80 DLTTCLQEGRWYFASESTEQYLQRKAAYERQCREQQSDWRVLTTALPPWEAHPRCRC 136 >09_04_0627 - 19061106-19061474,19062067-19062909,19063395-19063501, 19064301-19064332,19064384-19064663,19065092-19065475, 19066730-19066803,19067244-19067310,19067415-19067486, 19067941-19068000,19068683-19068734,19068874-19068943, 19069110-19069372 Length = 890 Score = 28.3 bits (60), Expect = 4.5 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 483 TPPGLSPMSLPTC 521 TPPGL P+ LPTC Sbjct: 384 TPPGLIPVGLPTC 396 >02_04_0206 + 20916063-20919669,20919816-20920014,20920935-20921074, 20921184-20921263,20922759-20922875,20923089-20923136, 20923509-20923601,20923881-20923958,20924114-20924218, 20924543-20925212,20925253-20925350,20925887-20925963, 20926035-20926117,20926208-20926287,20927060-20927139, 20927698-20927743,20928709-20929181,20929234-20929579 Length = 2139 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 297 LQTETHYCFTAEIGEVVVPARA*RCFSMNTMVSSIV 404 L + H+C + G +V+P R C SMNT V IV Sbjct: 2048 LSSPFHHCRPIQEGVLVLPLR---CLSMNTTVWDIV 2080 >01_04_0008 + 15041682-15041909,15042035-15042319,15042406-15042723, 15044087-15044128,15045111-15045391,15045808-15045883, 15046196-15046296,15047971-15048088,15048872-15049186 Length = 587 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +2 Query: 38 PHTRSPR*E---GARRPRRSTGRAPGPKK 115 P T SP + G RPRR GR PGP++ Sbjct: 4 PSTDSPAADQSPGRGRPRRRLGRKPGPRQ 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,015,153 Number of Sequences: 37544 Number of extensions: 334033 Number of successful extensions: 801 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -