BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0414 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 30 1.4 SB_40455| Best HMM Match : Ldl_recept_b (HMM E-Value=0.019) 30 1.9 SB_5725| Best HMM Match : Ldl_recept_b (HMM E-Value=0.019) 30 1.9 SB_31722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_10039| Best HMM Match : DUF1103 (HMM E-Value=3) 29 2.5 SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_41763| Best HMM Match : S_layer_C (HMM E-Value=1.2) 29 2.5 SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) 29 2.5 SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) 29 3.3 SB_31739| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_39894| Best HMM Match : Pox_A32 (HMM E-Value=0.59) 29 4.3 SB_35636| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_27139| Best HMM Match : Capsid_Iridovir (HMM E-Value=1.5) 29 4.3 SB_44159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_42076| Best HMM Match : DUF1103 (HMM E-Value=3.9) 29 4.3 SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) 29 4.3 SB_30293| Best HMM Match : Rho_N (HMM E-Value=0.0017) 28 5.7 SB_36494| Best HMM Match : DUF1103 (HMM E-Value=1.8) 28 5.7 SB_57927| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_57062| Best HMM Match : Pox_A32 (HMM E-Value=0.006) 28 7.5 SB_56989| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_50851| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_47775| Best HMM Match : Supt5 (HMM E-Value=9.7) 28 7.5 SB_46876| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_43364| Best HMM Match : Pox_A32 (HMM E-Value=0.0078) 28 7.5 SB_40151| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_39136| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_38626| Best HMM Match : Supt5 (HMM E-Value=9.7) 28 7.5 SB_37988| Best HMM Match : Rho_N (HMM E-Value=0.0007) 28 7.5 SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 7.5 SB_33960| Best HMM Match : Borrelia_orfA (HMM E-Value=2) 28 7.5 SB_33794| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_31612| Best HMM Match : Aminotran_1_2 (HMM E-Value=7.8e-12) 28 7.5 SB_30160| Best HMM Match : Supt5 (HMM E-Value=7.5) 28 7.5 SB_15820| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_2228| Best HMM Match : Pox_A32 (HMM E-Value=0.099) 28 7.5 SB_2134| Best HMM Match : Endonuclease_7 (HMM E-Value=0.057) 28 7.5 SB_2097| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_57540| Best HMM Match : Supt5 (HMM E-Value=9.7) 28 7.5 SB_36600| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_31661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_24327| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_23275| Best HMM Match : IncA (HMM E-Value=0.43) 28 7.5 SB_19114| Best HMM Match : E-MAP-115 (HMM E-Value=0.44) 28 7.5 SB_10414| Best HMM Match : Rho_N (HMM E-Value=0.0015) 28 7.5 SB_8805| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_3818| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 28 7.5 SB_1446| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 7.5 SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) 27 9.9 SB_14486| Best HMM Match : Vicilin_N (HMM E-Value=7) 27 9.9 SB_17631| Best HMM Match : DUF1103 (HMM E-Value=3.2) 27 9.9 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 107 LDTNSSMQPKAEVPPMCPKSKLPLLHLTPSGGQKKIEGATPQSKSNP 247 L + S P + VPP + P ++TP + + G P++K+ P Sbjct: 607 LPKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKP 653 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +2 Query: 62 VNGEEQITQRLKHIHLDTNSSMQPKAEVPPMCPKSKLP 175 V EE++TQ K L T S+ +P A+ PP P+ LP Sbjct: 657 VKEEERVTQPDKTSEL-TESTKRPAADAPPPTPEPSLP 693 >SB_40455| Best HMM Match : Ldl_recept_b (HMM E-Value=0.019) Length = 122 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 1 LQEFGTRVELTDCLNNNLNVCKR*RTNHTTIKTH 102 L G +V TD N NL VC+ +N T+KT+ Sbjct: 76 LDHVGRKVYFTDYFNKNLRVCELDGSNCKTLKTN 109 >SB_5725| Best HMM Match : Ldl_recept_b (HMM E-Value=0.019) Length = 409 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 1 LQEFGTRVELTDCLNNNLNVCKR*RTNHTTIKTH 102 L G +V TD N NL VC+ +N T+KT+ Sbjct: 226 LDHVGRKVYFTDYFNKNLRVCELDGSNCKTLKTN 259 >SB_31722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG+F Sbjct: 2 RKLRTNAGDKVTSDAKE--VALAAVHNTKYCIPLDHPILSEHGVF 44 >SB_10039| Best HMM Match : DUF1103 (HMM E-Value=3) Length = 270 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG+F Sbjct: 134 RKLRTNAGDKVTSDAKE--VALATVHNTKYCIPLDHPILSEHGVF 176 >SB_46228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 156 HMGGTSAFGCILLFVSKCMCFNRCVICSSPFTNIKII 46 H+ T+ G +FV KC+ F+R CSS F I+ + Sbjct: 29 HISSTNRDGIASVFV-KCLFFSRFAFCSSKFLAIEFL 64 >SB_41763| Best HMM Match : S_layer_C (HMM E-Value=1.2) Length = 393 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L+ KYC H ILSEHG F Sbjct: 134 RKLRTNAGDKVTSDAKE--VALVAVHNTKYCIPLNHPILSEHGAF 176 >SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) Length = 1970 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG+F Sbjct: 1377 RKLRTNAGDKVTSDAKE--VALAAVHNTKYCIPLDHPILSEHGVF 1419 >SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) Length = 348 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +2 Query: 92 LKHIHLDTNSSMQPKAEVPPMCPKSKLPLLHL-TPSGGQKKIEGATPQSKSNP 247 LK H + K E+ P CP PLLH +P + PQ+ + P Sbjct: 21 LKRGHPQRECRSKKKCEIVPSCPYFHHPLLHAHSPPASANAVTPIPPQADNVP 73 >SB_31739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 481 REKTSASLDLR-QFSVNCGMVISFIKDCCNYRNV 579 R + SA++ +R QFS N M+ F CC R+V Sbjct: 32 RSQFSANVRMRSQFSANVHMLAQFFPPCCEMRSV 65 >SB_39894| Best HMM Match : Pox_A32 (HMM E-Value=0.59) Length = 565 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG F Sbjct: 134 RKLRTNAGDKVTSDAKE--VALATVHNTKYCIPLDHPILSEHGAF 176 >SB_35636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG F Sbjct: 99 RKLRTNAGDKVTSDAKE--VALATVHNTKYCIPLDHPILSEHGAF 141 >SB_27139| Best HMM Match : Capsid_Iridovir (HMM E-Value=1.5) Length = 715 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG F Sbjct: 296 RKLRTNAGDKATSDAKE--VALATVHNTKYCIPLDHPILSEHGAF 338 >SB_44159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG F Sbjct: 67 RKLRTNAGDKVTSDAKE--VALATVHNTKYCIPLDHPILSEHGAF 109 >SB_42076| Best HMM Match : DUF1103 (HMM E-Value=3.9) Length = 235 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG F Sbjct: 134 RKLRTNAGDKVTSDAKE--VALATVHNTKYCIPLDHPILSEHGAF 176 >SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) Length = 1480 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H ILSEHG F Sbjct: 1301 RKLRTNAGDKVTSDAKE--VALAAVHNTKYCIPLNHPILSEHGAF 1343 >SB_30293| Best HMM Match : Rho_N (HMM E-Value=0.0017) Length = 1078 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 366 KYCYKWQHAILSEHGLF 416 KYC H ILSEHG F Sbjct: 826 KYCIPLDHPILSEHGAF 842 >SB_36494| Best HMM Match : DUF1103 (HMM E-Value=1.8) Length = 353 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNASDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_57927| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 212 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 76 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 118 >SB_57062| Best HMM Match : Pox_A32 (HMM E-Value=0.006) Length = 485 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 2 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 44 >SB_56989| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 835 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 699 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 741 >SB_50851| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 405 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_47775| Best HMM Match : Supt5 (HMM E-Value=9.7) Length = 280 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 2 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 44 >SB_46876| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 364 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_43364| Best HMM Match : Pox_A32 (HMM E-Value=0.0078) Length = 759 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_40151| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 348 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_39136| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 290 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 76 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 118 >SB_38626| Best HMM Match : Supt5 (HMM E-Value=9.7) Length = 280 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 2 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 44 >SB_37988| Best HMM Match : Rho_N (HMM E-Value=0.0007) Length = 1018 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 575 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 617 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 1839 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 1881 >SB_33960| Best HMM Match : Borrelia_orfA (HMM E-Value=2) Length = 662 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 526 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 568 >SB_33794| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 270 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_31612| Best HMM Match : Aminotran_1_2 (HMM E-Value=7.8e-12) Length = 398 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 630 VYLITYSLIDYYRHR*VHITIVTAIFNKTYHHTTI 526 + +IT ++I + I +T I N YHHTTI Sbjct: 59 ITIITITVITIITITVITIITITIIINYDYHHTTI 93 >SB_30160| Best HMM Match : Supt5 (HMM E-Value=7.5) Length = 280 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 2 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 44 >SB_15820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1998 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 1471 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 1513 >SB_2228| Best HMM Match : Pox_A32 (HMM E-Value=0.099) Length = 771 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 235 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 277 >SB_2134| Best HMM Match : Endonuclease_7 (HMM E-Value=0.057) Length = 1124 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 899 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 941 >SB_2097| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 375 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 239 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 281 >SB_57540| Best HMM Match : Supt5 (HMM E-Value=9.7) Length = 280 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 2 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 44 >SB_36600| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 412 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_31661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 864 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 185 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 227 >SB_24327| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 203 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_23275| Best HMM Match : IncA (HMM E-Value=0.43) Length = 1176 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_19114| Best HMM Match : E-MAP-115 (HMM E-Value=0.44) Length = 532 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 2 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 44 >SB_10414| Best HMM Match : Rho_N (HMM E-Value=0.0015) Length = 916 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 433 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 475 >SB_8805| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 201 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_3818| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 766 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_1446| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 235 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 282 RRLHNRKFNTTSSFRKE*GIFLLETLE*KYCYKWQHAILSEHGLF 416 R+L + +S KE + L KYC H IL EHG+F Sbjct: 134 RKLRTNAGDKATSDAKE--VALAAVHNTKYCIPLDHPILGEHGVF 176 >SB_23419| Best HMM Match : zf-A20 (HMM E-Value=1.8e-37) Length = 1188 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +1 Query: 388 MPFCQNTGFLESYKNMPRCIHNYVRISLKTNREKTSASLDLRQ 516 MP C+ G + Y C H ++ + TN + S ++ Q Sbjct: 706 MPGCRRPGVADLYGRCVECYHQCIKTFINTNEQIASPAVSSPQ 748 >SB_14486| Best HMM Match : Vicilin_N (HMM E-Value=7) Length = 278 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 155 CPK-SKLPLLHLTPSGGQKKIEGATPQSKSNPW 250 CPK + +L + +GG+KK++G S P+ Sbjct: 97 CPKETHYEILEVNVNGGEKKLQGRLDSSSGEPY 129 >SB_17631| Best HMM Match : DUF1103 (HMM E-Value=3.2) Length = 270 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 366 KYCYKWQHAILSEHGLF 416 KYC H IL EHG+F Sbjct: 160 KYCIPLDHPILGEHGVF 176 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,003,832 Number of Sequences: 59808 Number of extensions: 409873 Number of successful extensions: 1162 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1162 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -