BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0414 (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 26 0.27 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 26 0.27 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 4.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 4.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 4.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 4.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.4 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 7.8 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 7.8 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 26.2 bits (55), Expect = 0.27 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -3 Query: 462 TYIVMYTSWHIFVRLQKARVLTKWHAAIYNNTFILTSRVEKYPIPYGKNSW 310 TY ++Y IF + Q + + + I NN F S++E+ I + W Sbjct: 384 TYFILYDFNDIFEKDQASFLERERFLGIINNIFKNMSQIEREAITFQYTDW 434 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 26.2 bits (55), Expect = 0.27 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -3 Query: 462 TYIVMYTSWHIFVRLQKARVLTKWHAAIYNNTFILTSRVEKYPIPYGKNSW 310 TY ++Y IF + Q + + + I NN F S++E+ I + W Sbjct: 384 TYFILYDFNDIFEKDQASFLERERFLGIINNIFKNMSQIEREAITFQYTDW 434 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 570 IVTAIFNKTYHHTTIYRKL 514 I++++ N T H+ Y+KL Sbjct: 303 IISSLLNNTIHNNNNYKKL 321 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 570 IVTAIFNKTYHHTTIYRKL 514 I++++ N T H+ Y+KL Sbjct: 314 IISSLLNNTIHNNNNYKKL 332 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 570 IVTAIFNKTYHHTTIYRKL 514 I++++ N T H+ Y+KL Sbjct: 314 IISSLLNNTIHNNNNYKKL 332 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 570 IVTAIFNKTYHHTTIYRKL 514 I++++ N T H+ Y+KL Sbjct: 303 IISSLLNNTIHNNNNYKKL 321 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 140 EVPPMCPKSKLPLLHLTP 193 E P + P + L LLHLTP Sbjct: 876 EFPSVRPFAPLLLLHLTP 893 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 7.8 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 409 GFLESYKNMPRCIHNYVRISLKTNREKTSASLDLRQFSVN-CGMVISFIKD 558 G +Y N C++ Y R SL + T ++ SVN M I+ + D Sbjct: 99 GSCNNYWNTKNCVNPYDRDSLSCWLQMTKHHNFIKVCSVNDVNMTITELTD 149 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 7.8 Identities = 19/84 (22%), Positives = 32/84 (38%) Frame = +1 Query: 73 RTNHTTIKTHTFGYKQQYAAKSRGSSHVSKKQASVVAPHSFRWSEENRGRNTSKQV*SLA 252 + NH + K G ++ S ++ + + +S + N + S S Sbjct: 216 KNNHVSSKVEGNGVHEE---NSPLEDNIKCEPLELTGGNSGNAAGNNEDSSDSGAAASDR 272 Query: 253 TEASAGHPSHAASTIESSTPRVLS 324 ASA H A + +STP LS Sbjct: 273 PPASASSNEHEAESEHTSTPNFLS 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,739 Number of Sequences: 438 Number of extensions: 3739 Number of successful extensions: 16 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -