BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0412 (651 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001732-1|AAN71487.1| 199|Drosophila melanogaster RE70963p pro... 91 9e-19 AE014297-910|AAF54361.2| 199|Drosophila melanogaster CG33936-PB... 91 9e-19 AE014297-909|AAF54360.2| 199|Drosophila melanogaster CG33936-PA... 91 9e-19 AJ421016-1|CAD12856.1| 206|Drosophila melanogaster hypothetical... 91 2e-18 AY058763-1|AAL13992.1| 696|Drosophila melanogaster SD03358p pro... 53 3e-07 AE014296-213|AAF47467.1| 696|Drosophila melanogaster CG9139-PA ... 53 3e-07 AY061244-1|AAL28792.1| 664|Drosophila melanogaster LD18373p pro... 30 2.4 AE014298-1641|AAF48061.1| 664|Drosophila melanogaster CG11696-P... 30 2.4 AF162681-1|AAD50777.1| 737|Drosophila melanogaster maroon-like ... 30 3.1 AY118814-1|AAM50674.1| 448|Drosophila melanogaster GH23407p pro... 29 7.2 AY061576-1|AAL29124.1| 987|Drosophila melanogaster SD02803p pro... 29 7.2 AE014134-2440|AAF53361.2| 448|Drosophila melanogaster CG33115-P... 29 7.2 >BT001732-1|AAN71487.1| 199|Drosophila melanogaster RE70963p protein. Length = 199 Score = 91.5 bits (217), Expect = 9e-19 Identities = 35/46 (76%), Positives = 44/46 (95%) Frame = +2 Query: 512 MERESNPMEALCRSGCGFYGNPSTDGLCSVCFKEALKKKQQPPATT 649 MERESNPM+ +CRSGCGFYGNP+TDGLCSVC+K++L+KKQQPP ++ Sbjct: 1 MERESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSS 46 >AE014297-910|AAF54361.2| 199|Drosophila melanogaster CG33936-PB, isoform B protein. Length = 199 Score = 91.5 bits (217), Expect = 9e-19 Identities = 35/46 (76%), Positives = 44/46 (95%) Frame = +2 Query: 512 MERESNPMEALCRSGCGFYGNPSTDGLCSVCFKEALKKKQQPPATT 649 MERESNPM+ +CRSGCGFYGNP+TDGLCSVC+K++L+KKQQPP ++ Sbjct: 1 MERESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSS 46 >AE014297-909|AAF54360.2| 199|Drosophila melanogaster CG33936-PA, isoform A protein. Length = 199 Score = 91.5 bits (217), Expect = 9e-19 Identities = 35/46 (76%), Positives = 44/46 (95%) Frame = +2 Query: 512 MERESNPMEALCRSGCGFYGNPSTDGLCSVCFKEALKKKQQPPATT 649 MERESNPM+ +CRSGCGFYGNP+TDGLCSVC+K++L+KKQQPP ++ Sbjct: 1 MERESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSS 46 >AJ421016-1|CAD12856.1| 206|Drosophila melanogaster hypothetical protein protein. Length = 206 Score = 90.6 bits (215), Expect = 2e-18 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = +2 Query: 512 MERESNPMEALCRSGCGFYGNPSTDGLCSVCFKEALKKKQQPPATT 649 MERESNPM+ +CRSGCGFYGNP+TDGLCSVC+K++L KKQQPP ++ Sbjct: 1 MERESNPMQPMCRSGCGFYGNPATDGLCSVCYKDSLSKKQQPPVSS 46 >AY058763-1|AAL13992.1| 696|Drosophila melanogaster SD03358p protein. Length = 696 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 545 CRSGCGFYGNPSTDGLCSVCFKEALKKKQQ 634 CRSGCGFYG P +GLCS+CF+E KQ+ Sbjct: 19 CRSGCGFYGTPQNEGLCSMCFREKFNDKQR 48 >AE014296-213|AAF47467.1| 696|Drosophila melanogaster CG9139-PA protein. Length = 696 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 545 CRSGCGFYGNPSTDGLCSVCFKEALKKKQQ 634 CRSGCGFYG P +GLCS+CF+E KQ+ Sbjct: 19 CRSGCGFYGTPQNEGLCSMCFREKFNDKQR 48 >AY061244-1|AAL28792.1| 664|Drosophila melanogaster LD18373p protein. Length = 664 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -2 Query: 308 VYDRYFCVRTFEGHTVV--EKESFEPNKCLSKCAVPSAHKQATPRLCGCSQHP 156 +Y FC RTF+ H + K+ PN + K + PS+ +T HP Sbjct: 562 LYQCQFCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSSITSTAAPLAHPNHP 614 >AE014298-1641|AAF48061.1| 664|Drosophila melanogaster CG11696-PA protein. Length = 664 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -2 Query: 308 VYDRYFCVRTFEGHTVV--EKESFEPNKCLSKCAVPSAHKQATPRLCGCSQHP 156 +Y FC RTF+ H + K+ PN + K + PS+ +T HP Sbjct: 562 LYQCQFCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSSITSTAAPLAHPNHP 614 >AF162681-1|AAD50777.1| 737|Drosophila melanogaster maroon-like protein protein. Length = 737 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 185 VSLVCELKGLRTWKDICLVRNSLFQQQCVLQ 277 +S+V L+G W+D C R +LF C+ + Sbjct: 306 LSIVGLLEGFERWRDWCPERTTLFSNHCIFR 336 >AY118814-1|AAM50674.1| 448|Drosophila melanogaster GH23407p protein. Length = 448 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 518 RESNPMEALCRSGCGFYGNPSTDGLC 595 R EA+C GCGFYG +C Sbjct: 340 RNRERCEAVCVGGCGFYGKCIAPNVC 365 >AY061576-1|AAL29124.1| 987|Drosophila melanogaster SD02803p protein. Length = 987 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 380 TNLLSNVGQVTSGLCSAQQFSLLVVYDRYFCVRTFEGHTVVEK 252 T LL + +C+ + FSLL+ + + +C F HT +EK Sbjct: 373 TALLETKHTIQQAICATEYFSLLLDFFKQYCWNNFL-HTEMEK 414 >AE014134-2440|AAF53361.2| 448|Drosophila melanogaster CG33115-PA protein. Length = 448 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 518 RESNPMEALCRSGCGFYGNPSTDGLC 595 R EA+C GCGFYG +C Sbjct: 340 RNRERCEAVCVGGCGFYGKCIAPNVC 365 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,464,212 Number of Sequences: 53049 Number of extensions: 559981 Number of successful extensions: 1228 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -