BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0412 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.48 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.5 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.4 bits (53), Expect = 0.48 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 116 LQIMVL*PFIVMPVDADYNRTDVVSLVCELKGLRT 220 LQ+ V +IV P D R V+L C+ +G+ T Sbjct: 704 LQVKVPPRWIVEPTDVSVERNKHVALHCQAQGVPT 738 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 2 KFLDDFLSNF-YSKTNNH*ENLRMMWNNKHSQ*QYINFVLQI 124 K + +N+ YS NN+ +NN + + Y N+++ I Sbjct: 313 KIISSLSNNYKYSNYNNYNNYNNNNYNNYNKKLYYKNYIINI 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,185 Number of Sequences: 438 Number of extensions: 3510 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -