BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0411 (422 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0034 - 12663290-12663355,12663437-12663566,12663903-126639... 32 0.22 10_07_0176 - 13826764-13827064,13827271-13827377,13827474-138278... 30 0.88 10_08_0614 - 19238064-19238132,19238381-19238407,19238436-192385... 27 8.2 >07_03_0034 - 12663290-12663355,12663437-12663566,12663903-12663990, 12664106-12664178,12666144-12666248,12667610-12667732, 12667821-12667897,12668877-12669006 Length = 263 Score = 31.9 bits (69), Expect = 0.22 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 341 WFTESCDMWPGGTFSFEVKEVLHTEKS 421 WF+E MWPG S +V++VL KS Sbjct: 34 WFSEISPMWPGEAHSLKVEKVLFQGKS 60 >10_07_0176 - 13826764-13827064,13827271-13827377,13827474-13827836, 13827912-13828079,13828153-13828374,13828784-13829023, 13829640-13829719,13829853-13830018,13830720-13830783, 13830861-13830962,13831085-13831227,13831370-13831474, 13831551-13831706,13832125-13832241,13832315-13832392, 13832466-13832550,13833334-13833455,13833546-13833611, 13835190-13835284,13835427-13835523,13835873-13835983, 13836083-13836164,13836292-13836353,13836620-13836685, 13838002-13838232 Length = 1142 Score = 29.9 bits (64), Expect = 0.88 Identities = 14/42 (33%), Positives = 27/42 (64%) Frame = -1 Query: 197 IKTRFALLTNSTLLNSHFTITIYMSKDMIRYI*QTETLDNDL 72 + T + T TL ++ I++Y+S +MI++I T+ ++NDL Sbjct: 339 VVTILTMFTLITLYSTIIPISLYVSIEMIKFIQCTQFINNDL 380 >10_08_0614 - 19238064-19238132,19238381-19238407,19238436-19238510, 19238637-19239317,19239423-19239554,19239676-19239723, 19239828-19239878,19240015-19240134,19241121-19241261, 19241701-19241865,19241981-19242160,19242314-19242445, 19242536-19242643,19242779-19242883,19243217-19243321, 19243407-19243463,19243991-19244010,19244299-19244377, 19245021-19245080,19245562-19245615,19246535-19246600, 19246938-19246990,19247361-19247450,19248152-19248249, 19248348-19248721 Length = 1029 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +1 Query: 157 SNVEFVRRAKRVFIFRARNTLF-EREIVK 240 + ++F RAKRV I+ ARN + E+ ++K Sbjct: 404 NTLKFASRAKRVEIYAARNRMIDEKSLIK 432 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,861,395 Number of Sequences: 37544 Number of extensions: 164518 Number of successful extensions: 309 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -